BLASTX nr result
ID: Bupleurum21_contig00009500
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00009500 (353 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFW16645.1| putative progesterone 5beta-reductase [Bupleurum ... 76 2e-12 gb|AFZ42257.1| putative progesterone 5-beta-reductase, partial [... 65 6e-09 gb|ADG46022.1| progesterone 5-beta-reductase [Mentha x piperita] 64 1e-08 ref|XP_004152001.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r... 63 3e-08 ref|XP_002326977.1| predicted protein [Populus trichocarpa] gi|2... 62 4e-08 >gb|AFW16645.1| putative progesterone 5beta-reductase [Bupleurum falcatum] Length = 388 Score = 76.3 bits (186), Expect = 2e-12 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -3 Query: 351 DTMNKSKEHGFLGFRNSKTSFITWINKLKDSKVVP 247 DTMNKSKEHGFLGFRNSKTSFITWINKLKDSKVVP Sbjct: 354 DTMNKSKEHGFLGFRNSKTSFITWINKLKDSKVVP 388 >gb|AFZ42257.1| putative progesterone 5-beta-reductase, partial [Thymus serpyllum] Length = 389 Score = 65.1 bits (157), Expect = 6e-09 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -3 Query: 351 DTMNKSKEHGFLGFRNSKTSFITWINKLKDSKVVP 247 DTMNKSKEHGFLGFRNSK SFI+WI+KLK K+VP Sbjct: 355 DTMNKSKEHGFLGFRNSKNSFISWIDKLKAYKIVP 389 >gb|ADG46022.1| progesterone 5-beta-reductase [Mentha x piperita] Length = 389 Score = 63.9 bits (154), Expect = 1e-08 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = -3 Query: 351 DTMNKSKEHGFLGFRNSKTSFITWINKLKDSKVVP 247 DTMNKSKEHGFLGFRNSK SFI+WI+K+K K+VP Sbjct: 355 DTMNKSKEHGFLGFRNSKNSFISWIDKVKAYKIVP 389 >ref|XP_004152001.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Cucumis sativus] gi|449509429|ref|XP_004163586.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Cucumis sativus] Length = 394 Score = 62.8 bits (151), Expect = 3e-08 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = -3 Query: 351 DTMNKSKEHGFLGFRNSKTSFITWINKLKDSKVVP 247 D+MNKSKEHGFLGFRNSK SFI+WI+K+K K+VP Sbjct: 360 DSMNKSKEHGFLGFRNSKNSFISWIDKIKAFKIVP 394 >ref|XP_002326977.1| predicted protein [Populus trichocarpa] gi|222835292|gb|EEE73727.1| predicted protein [Populus trichocarpa] Length = 391 Score = 62.4 bits (150), Expect = 4e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -3 Query: 348 TMNKSKEHGFLGFRNSKTSFITWINKLKDSKVVP 247 +MNKSKEHGFLGFRNSK SFI+WI K+K SKVVP Sbjct: 358 SMNKSKEHGFLGFRNSKKSFISWIEKMKASKVVP 391