BLASTX nr result
ID: Bupleurum21_contig00008889
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00008889 (373 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002310466.1| predicted protein [Populus trichocarpa] gi|2... 62 5e-08 ref|XP_002515724.1| DNA binding protein, putative [Ricinus commu... 59 3e-07 ref|XP_004151928.1| PREDICTED: uncharacterized protein LOC101206... 57 1e-06 ref|XP_004159222.1| PREDICTED: uncharacterized protein LOC101223... 57 2e-06 ref|NP_001236343.1| uncharacterized protein LOC100500322 [Glycin... 55 5e-06 >ref|XP_002310466.1| predicted protein [Populus trichocarpa] gi|222853369|gb|EEE90916.1| predicted protein [Populus trichocarpa] Length = 125 Score = 62.0 bits (149), Expect = 5e-08 Identities = 27/42 (64%), Positives = 32/42 (76%) Frame = +1 Query: 1 ANFLAQRHIRCFLCTNCRAFTNRYLIGVSAQVLLPTIVCKKE 126 ANFLAQRH+RC LC C+ T RYLIG S ++LLPTIV +E Sbjct: 61 ANFLAQRHVRCMLCNTCQNLTQRYLIGASTELLLPTIVSWRE 102 >ref|XP_002515724.1| DNA binding protein, putative [Ricinus communis] gi|223545161|gb|EEF46671.1| DNA binding protein, putative [Ricinus communis] Length = 131 Score = 59.3 bits (142), Expect = 3e-07 Identities = 25/38 (65%), Positives = 30/38 (78%) Frame = +1 Query: 1 ANFLAQRHIRCFLCTNCRAFTNRYLIGVSAQVLLPTIV 114 ANFLA RHIRCFLC C+ T RYLIG S +++LPT+V Sbjct: 64 ANFLANRHIRCFLCNTCQNLTQRYLIGASVEMVLPTMV 101 >ref|XP_004151928.1| PREDICTED: uncharacterized protein LOC101206571 [Cucumis sativus] Length = 133 Score = 57.4 bits (137), Expect = 1e-06 Identities = 30/67 (44%), Positives = 41/67 (61%) Frame = +1 Query: 1 ANFLAQRHIRCFLCTNCRAFTNRYLIGVSAQVLLPTIVCKKESIENHSTDDLDAVQQPNY 180 ANFLA RHIRC LC C+ T +YL+G S +VLLPTI+ E+ + ++ + + P Sbjct: 67 ANFLALRHIRCILCNVCQNLTQKYLMGTSTEVLLPTIIACAEANDCNNNGN----RNPCC 122 Query: 181 SNQFIRP 201 S F RP Sbjct: 123 SVMFKRP 129 >ref|XP_004159222.1| PREDICTED: uncharacterized protein LOC101223629 [Cucumis sativus] Length = 132 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/57 (45%), Positives = 38/57 (66%), Gaps = 1/57 (1%) Frame = +1 Query: 1 ANFLAQRHIRCFLCTNCRAFTNRYLIGVSAQVLL-PTIVCKKESIENHSTDDLDAVQ 168 ANFLA RH+RC LC C++ T RYL+G S +V+L P++V ++ + N+ D VQ Sbjct: 63 ANFLALRHVRCLLCNTCQSHTQRYLLGASMEVVLPPSLVSRERNFLNYHCDSDSFVQ 119 >ref|NP_001236343.1| uncharacterized protein LOC100500322 [Glycine max] gi|255630020|gb|ACU15362.1| unknown [Glycine max] Length = 124 Score = 55.5 bits (132), Expect = 5e-06 Identities = 24/35 (68%), Positives = 27/35 (77%) Frame = +1 Query: 1 ANFLAQRHIRCFLCTNCRAFTNRYLIGVSAQVLLP 105 ANFLA RHIRCFLC C+ T RYLIG S +V+LP Sbjct: 59 ANFLALRHIRCFLCNTCQNLTRRYLIGASIEVVLP 93