BLASTX nr result
ID: Bupleurum21_contig00008748
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00008748 (420 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAM29152.1| plastidic ATP/ADP transporter [Citrus hybrid cult... 57 2e-06 gb|AAZ23106.1| plastid ATP/ADP transport protein 1 [Manihot escu... 55 4e-06 >gb|AAM29152.1| plastidic ATP/ADP transporter [Citrus hybrid cultivar] Length = 588 Score = 57.0 bits (136), Expect = 2e-06 Identities = 32/50 (64%), Positives = 33/50 (66%) Frame = -2 Query: 419 LVIVLAWLAAARSLDTQFTXXXXXXXXXXXXXXXAVKIPVVSENEPGNGS 270 LVIVLAWL AARSLDTQFT AVKIPVVSENE GNG+ Sbjct: 528 LVIVLAWLGAARSLDTQFTALRQEEELEKEMERAAVKIPVVSENEGGNGT 577 >gb|AAZ23106.1| plastid ATP/ADP transport protein 1 [Manihot esculenta] Length = 619 Score = 55.5 bits (132), Expect = 4e-06 Identities = 30/50 (60%), Positives = 33/50 (66%) Frame = -2 Query: 419 LVIVLAWLAAARSLDTQFTXXXXXXXXXXXXXXXAVKIPVVSENEPGNGS 270 LVIVLAWLAAA+SLDTQFT +VKIPVVS+ E GNGS Sbjct: 548 LVIVLAWLAAAKSLDTQFTALRKEEELEKEMERASVKIPVVSQEESGNGS 597