BLASTX nr result
ID: Bupleurum21_contig00008623
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00008623 (282 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516970.1| chaperone binding protein, putative [Ricinus... 55 6e-06 >ref|XP_002516970.1| chaperone binding protein, putative [Ricinus communis] gi|223544058|gb|EEF45584.1| chaperone binding protein, putative [Ricinus communis] Length = 508 Score = 55.1 bits (131), Expect = 6e-06 Identities = 32/72 (44%), Positives = 46/72 (63%), Gaps = 2/72 (2%) Frame = -2 Query: 281 KSANPGGPSMKS--AXXXXXXXXXGNKDPFGSLLDFSSKKPAMATGVNANNKGNIKKTNL 108 KS+N GGPSM + + G +DPFGSL+DF SK+ A G+N+ +K ++K ++ Sbjct: 196 KSSNLGGPSMTNMMSGSGVGGGMGGGRDPFGSLVDFGSKQ--QAGGLNSASKSSVKTSSG 253 Query: 107 VDNGFGDFQKAT 72 +GFGDFQ AT Sbjct: 254 GKDGFGDFQNAT 265