BLASTX nr result
ID: Bupleurum21_contig00008621
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00008621 (306 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516970.1| chaperone binding protein, putative [Ricinus... 70 1e-10 >ref|XP_002516970.1| chaperone binding protein, putative [Ricinus communis] gi|223544058|gb|EEF45584.1| chaperone binding protein, putative [Ricinus communis] Length = 508 Score = 70.5 bits (171), Expect = 1e-10 Identities = 40/80 (50%), Positives = 52/80 (65%), Gaps = 2/80 (2%) Frame = +2 Query: 2 GNVNLGSCNNSNPGGPSMKSA-GVSGLEGGMGNN-DPFGSLFDFSSKKPAMATGVNANNK 175 GN N+ S +SN GGPSM + SG+ GGMG DPFGSL DF SK+ A G+N+ +K Sbjct: 188 GNANISSNKSSNLGGPSMTNMMSGSGVGGGMGGGRDPFGSLVDFGSKQ--QAGGLNSASK 245 Query: 176 GNIKKTNSVDDDFGDFQKAT 235 ++K ++ D FGDFQ AT Sbjct: 246 SSVKTSSGGKDGFGDFQNAT 265