BLASTX nr result
ID: Bupleurum21_contig00008425
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00008425 (658 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN61989.1| hypothetical protein VITISV_015656 [Vitis vinifera] 66 5e-09 >emb|CAN61989.1| hypothetical protein VITISV_015656 [Vitis vinifera] Length = 1048 Score = 66.2 bits (160), Expect = 5e-09 Identities = 36/57 (63%), Positives = 39/57 (68%) Frame = +2 Query: 425 LMLQSSNMPTRLNAGSLLLVGDLTMKKGLGQPYPNWSGTGAVLLMSPRQGETSSCPG 595 ++LQSS PT+L GSL LV DLTMKK L Y NWSG GAV LMSP Q ETS G Sbjct: 937 MLLQSSGRPTQLCLGSLSLVKDLTMKKTLAISYTNWSGVGAVPLMSPWQDETSQHSG 993