BLASTX nr result
ID: Bupleurum21_contig00008195
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00008195 (389 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531626.1| conserved hypothetical protein [Ricinus comm... 55 4e-06 >ref|XP_002531626.1| conserved hypothetical protein [Ricinus communis] gi|223528744|gb|EEF30754.1| conserved hypothetical protein [Ricinus communis] Length = 111 Score = 55.5 bits (132), Expect = 4e-06 Identities = 37/98 (37%), Positives = 50/98 (51%) Frame = +2 Query: 95 LLFLLSLYICIILTGSCKVNAIRILQHQQNQTFVDSDISRHDQENINGVKKIMTEAGHFR 274 L+FLL ++IC CK AIR N + + R + NI ++ FR Sbjct: 23 LIFLLQIWIC----SDCKAEAIRAFPDNSNSNNSNMEKLRERRRNIPADHNA-SKVDLFR 77 Query: 275 QLFNGRVSPNSHLKNKNQNTSLDDKGFQDNKRRVPSCP 388 + F+GRVS + N T +KGF+DNKRRVPSCP Sbjct: 78 KFFDGRVS------SFNNRT---EKGFEDNKRRVPSCP 106