BLASTX nr result
ID: Bupleurum21_contig00008118
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00008118 (329 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAF74981.1|AF082891_1 cystathionine gamma-synthase isoform 1 ... 124 1e-26 ref|NP_001234489.1| cystathionine gamma synthase [Solanum lycope... 124 1e-26 pdb|1QGN|A Chain A, Cystathionine Gamma-Synthase From Nicotiana ... 122 2e-26 emb|CBI22246.3| unnamed protein product [Vitis vinifera] 120 9e-26 ref|XP_002283866.1| PREDICTED: cystathionine gamma-synthase, chl... 120 9e-26 >gb|AAF74981.1|AF082891_1 cystathionine gamma-synthase isoform 1 [Solanum tuberosum] Length = 539 Score = 124 bits (310), Expect = 1e-26 Identities = 58/63 (92%), Positives = 62/63 (98%) Frame = +3 Query: 3 PYIAPSFGGCESIVDQPAIMSYWDLSQADRAKYGILDNLVRFSFGVEDFEDLKTDVLQAL 182 PYIAPSFGGCESIVDQPAIMSYWDLSQ+DRAKYGILDNLVRFSFGVEDFED+K DVLQAL Sbjct: 477 PYIAPSFGGCESIVDQPAIMSYWDLSQSDRAKYGILDNLVRFSFGVEDFEDVKADVLQAL 536 Query: 183 ETI 191 ++I Sbjct: 537 DSI 539 >ref|NP_001234489.1| cystathionine gamma synthase [Solanum lycopersicum] gi|40806079|gb|AAR92031.1| cystathionine gamma synthase [Solanum lycopersicum] Length = 540 Score = 124 bits (310), Expect = 1e-26 Identities = 58/63 (92%), Positives = 62/63 (98%) Frame = +3 Query: 3 PYIAPSFGGCESIVDQPAIMSYWDLSQADRAKYGILDNLVRFSFGVEDFEDLKTDVLQAL 182 PYIAPSFGGCESIVDQPAIMSYWDLSQ+DRAKYGILDNLVRFSFGVEDFED+K DVLQAL Sbjct: 478 PYIAPSFGGCESIVDQPAIMSYWDLSQSDRAKYGILDNLVRFSFGVEDFEDVKADVLQAL 537 Query: 183 ETI 191 ++I Sbjct: 538 DSI 540 >pdb|1QGN|A Chain A, Cystathionine Gamma-Synthase From Nicotiana Tabacum gi|5822271|pdb|1QGN|B Chain B, Cystathionine Gamma-Synthase From Nicotiana Tabacum gi|5822272|pdb|1QGN|C Chain C, Cystathionine Gamma-Synthase From Nicotiana Tabacum gi|5822273|pdb|1QGN|D Chain D, Cystathionine Gamma-Synthase From Nicotiana Tabacum gi|5822274|pdb|1QGN|E Chain E, Cystathionine Gamma-Synthase From Nicotiana Tabacum gi|5822275|pdb|1QGN|F Chain F, Cystathionine Gamma-Synthase From Nicotiana Tabacum gi|5822276|pdb|1QGN|G Chain G, Cystathionine Gamma-Synthase From Nicotiana Tabacum gi|5822277|pdb|1QGN|H Chain H, Cystathionine Gamma-Synthase From Nicotiana Tabacum gi|15826471|pdb|1I41|A Chain A, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826472|pdb|1I41|B Chain B, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826473|pdb|1I41|C Chain C, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826474|pdb|1I41|D Chain D, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826475|pdb|1I41|E Chain E, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826476|pdb|1I41|F Chain F, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826477|pdb|1I41|G Chain G, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826478|pdb|1I41|H Chain H, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826479|pdb|1I41|I Chain I, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826480|pdb|1I41|J Chain J, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826481|pdb|1I41|K Chain K, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826482|pdb|1I41|L Chain L, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826483|pdb|1I43|A Chain A, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826484|pdb|1I43|B Chain B, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826485|pdb|1I43|C Chain C, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826486|pdb|1I43|D Chain D, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826487|pdb|1I43|E Chain E, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826488|pdb|1I43|F Chain F, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826489|pdb|1I43|G Chain G, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826490|pdb|1I43|H Chain H, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826491|pdb|1I43|I Chain I, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826492|pdb|1I43|J Chain J, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826493|pdb|1I43|K Chain K, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826494|pdb|1I43|L Chain L, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826495|pdb|1I48|A Chain A, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826496|pdb|1I48|B Chain B, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826497|pdb|1I48|C Chain C, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826498|pdb|1I48|D Chain D, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826499|pdb|1I48|E Chain E, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826500|pdb|1I48|F Chain F, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826501|pdb|1I48|G Chain G, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826502|pdb|1I48|H Chain H, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826503|pdb|1I48|I Chain I, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826504|pdb|1I48|J Chain J, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826505|pdb|1I48|K Chain K, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826506|pdb|1I48|L Chain L, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|4322948|gb|AAD16143.1| cystathionine gamma-synthase precursor [Nicotiana tabacum] Length = 445 Score = 122 bits (307), Expect = 2e-26 Identities = 56/63 (88%), Positives = 62/63 (98%) Frame = +3 Query: 3 PYIAPSFGGCESIVDQPAIMSYWDLSQADRAKYGILDNLVRFSFGVEDFEDLKTDVLQAL 182 PYIAPSFGGCESIVDQPAIMSYWDLSQ+DRAKYGI+DNLVRFSFGVEDF+DLK D+LQAL Sbjct: 383 PYIAPSFGGCESIVDQPAIMSYWDLSQSDRAKYGIMDNLVRFSFGVEDFDDLKADILQAL 442 Query: 183 ETI 191 ++I Sbjct: 443 DSI 445 >emb|CBI22246.3| unnamed protein product [Vitis vinifera] Length = 497 Score = 120 bits (302), Expect = 9e-26 Identities = 56/63 (88%), Positives = 61/63 (96%) Frame = +3 Query: 3 PYIAPSFGGCESIVDQPAIMSYWDLSQADRAKYGILDNLVRFSFGVEDFEDLKTDVLQAL 182 PYIAPSFGGCESIVDQPAIMSYWDL+Q++RAKYGI DNLVRFSFGVEDFEDLK D+LQAL Sbjct: 435 PYIAPSFGGCESIVDQPAIMSYWDLNQSERAKYGIQDNLVRFSFGVEDFEDLKADILQAL 494 Query: 183 ETI 191 E+I Sbjct: 495 ESI 497 >ref|XP_002283866.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Vitis vinifera] Length = 531 Score = 120 bits (302), Expect = 9e-26 Identities = 56/63 (88%), Positives = 61/63 (96%) Frame = +3 Query: 3 PYIAPSFGGCESIVDQPAIMSYWDLSQADRAKYGILDNLVRFSFGVEDFEDLKTDVLQAL 182 PYIAPSFGGCESIVDQPAIMSYWDL+Q++RAKYGI DNLVRFSFGVEDFEDLK D+LQAL Sbjct: 469 PYIAPSFGGCESIVDQPAIMSYWDLNQSERAKYGIQDNLVRFSFGVEDFEDLKADILQAL 528 Query: 183 ETI 191 E+I Sbjct: 529 ESI 531