BLASTX nr result
ID: Bupleurum21_contig00007735
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00007735 (342 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003631488.1| PREDICTED: 26S proteasome non-ATPase regulat... 65 4e-09 emb|CBI33798.3| unnamed protein product [Vitis vinifera] 65 4e-09 ref|XP_002275168.1| PREDICTED: 26S proteasome non-ATPase regulat... 65 4e-09 ref|XP_004146109.1| PREDICTED: 26S proteasome non-ATPase regulat... 65 6e-09 ref|XP_002304360.1| predicted protein [Populus trichocarpa] gi|2... 64 1e-08 >ref|XP_003631488.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 13-like isoform 2 [Vitis vinifera] Length = 400 Score = 65.5 bits (158), Expect = 4e-09 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -3 Query: 340 QIKSLRDRLDNWVGKVHTALLSVEAETPDLVAS 242 QIKSLRDRLDNWV KVHTALLSVEAETPDLVAS Sbjct: 368 QIKSLRDRLDNWVDKVHTALLSVEAETPDLVAS 400 >emb|CBI33798.3| unnamed protein product [Vitis vinifera] Length = 181 Score = 65.5 bits (158), Expect = 4e-09 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -3 Query: 340 QIKSLRDRLDNWVGKVHTALLSVEAETPDLVAS 242 QIKSLRDRLDNWV KVHTALLSVEAETPDLVAS Sbjct: 149 QIKSLRDRLDNWVDKVHTALLSVEAETPDLVAS 181 >ref|XP_002275168.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 13-like isoform 1 [Vitis vinifera] Length = 386 Score = 65.5 bits (158), Expect = 4e-09 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -3 Query: 340 QIKSLRDRLDNWVGKVHTALLSVEAETPDLVAS 242 QIKSLRDRLDNWV KVHTALLSVEAETPDLVAS Sbjct: 354 QIKSLRDRLDNWVDKVHTALLSVEAETPDLVAS 386 >ref|XP_004146109.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 13-like [Cucumis sativus] gi|449509507|ref|XP_004163608.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 13-like [Cucumis sativus] Length = 386 Score = 65.1 bits (157), Expect = 6e-09 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -3 Query: 340 QIKSLRDRLDNWVGKVHTALLSVEAETPDLVAS 242 QIKSLRDRLDNWV KVHTALLSVEAETPDLVAS Sbjct: 354 QIKSLRDRLDNWVEKVHTALLSVEAETPDLVAS 386 >ref|XP_002304360.1| predicted protein [Populus trichocarpa] gi|222841792|gb|EEE79339.1| predicted protein [Populus trichocarpa] Length = 386 Score = 64.3 bits (155), Expect = 1e-08 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -3 Query: 340 QIKSLRDRLDNWVGKVHTALLSVEAETPDLVAS 242 QIKSLRDRLDNW+ KVHTALLSVEAETPDLVAS Sbjct: 354 QIKSLRDRLDNWLDKVHTALLSVEAETPDLVAS 386