BLASTX nr result
ID: Bupleurum21_contig00007704
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00007704 (358 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|P22243.1|STAD_CARTI RecName: Full=Acyl-[acyl-carrier-protein]... 169 2e-40 gb|ABF66638.1| stearoyl-acyl-carrier protein desaturase [Saussur... 165 3e-39 gb|AAA74692.1| stearoyl-acyl-carrier protein desaturase, partial... 160 8e-38 pdb|1OQ4|A Chain A, The Crystal Structure Of The Complex Between... 160 8e-38 pdb|2J2F|A Chain A, The T199d Mutant Of Stearoyl Acyl Carrier Pr... 160 8e-38 >sp|P22243.1|STAD_CARTI RecName: Full=Acyl-[acyl-carrier-protein] desaturase, chloroplastic; AltName: Full=Stearoyl-ACP desaturase; Flags: Precursor gi|167197|gb|AAA33021.1| stearoyl-acyl-carrier protein desaturase [Carthamus tinctorius] Length = 396 Score = 169 bits (428), Expect = 2e-40 Identities = 81/91 (89%), Positives = 86/91 (94%) Frame = +3 Query: 3 GKDDNLFEHFSAVAQRLQVYTAQDYADILEFLVGRWKVANLTGLSGEGRKAQDYVCGLPP 182 G+DDNLFEHFSAVAQRL VYTA+DYADILEFLVGRWKVA+LTGLSGEGRKAQDYVCGLPP Sbjct: 306 GRDDNLFEHFSAVAQRLGVYTAKDYADILEFLVGRWKVADLTGLSGEGRKAQDYVCGLPP 365 Query: 183 RIRRLQERAQERAKEAGTVPFSWIFDRQIKL 275 RIRRL+ERAQ RAKE VPFSWIFDRQ+KL Sbjct: 366 RIRRLEERAQGRAKEGPVVPFSWIFDRQVKL 396 >gb|ABF66638.1| stearoyl-acyl-carrier protein desaturase [Saussurea involucrata] Length = 396 Score = 165 bits (418), Expect = 3e-39 Identities = 79/91 (86%), Positives = 85/91 (93%) Frame = +3 Query: 3 GKDDNLFEHFSAVAQRLQVYTAQDYADILEFLVGRWKVANLTGLSGEGRKAQDYVCGLPP 182 G DDNLF+HFSAVAQRL VYTA+DYADILEFLVGRWKVA+LTGLSGEGRKAQDYVCGLPP Sbjct: 306 GHDDNLFDHFSAVAQRLGVYTAKDYADILEFLVGRWKVADLTGLSGEGRKAQDYVCGLPP 365 Query: 183 RIRRLQERAQERAKEAGTVPFSWIFDRQIKL 275 RIR+L+ERAQ RAKE VPFSWIFDRQ+KL Sbjct: 366 RIRKLEERAQGRAKEGPIVPFSWIFDRQVKL 396 >gb|AAA74692.1| stearoyl-acyl-carrier protein desaturase, partial [Ricinus communis] Length = 412 Score = 160 bits (406), Expect = 8e-38 Identities = 77/91 (84%), Positives = 84/91 (92%) Frame = +3 Query: 3 GKDDNLFEHFSAVAQRLQVYTAQDYADILEFLVGRWKVANLTGLSGEGRKAQDYVCGLPP 182 G+DDNLF+HFSAVAQRL VYTA+DYADILEFLVGRWKV LTGLS EG+KAQDYVC LPP Sbjct: 322 GRDDNLFDHFSAVAQRLGVYTAKDYADILEFLVGRWKVDKLTGLSAEGQKAQDYVCRLPP 381 Query: 183 RIRRLQERAQERAKEAGTVPFSWIFDRQIKL 275 RIRRL+ERAQ RAKEA T+PFSWIFDRQ+KL Sbjct: 382 RIRRLEERAQGRAKEAPTMPFSWIFDRQVKL 412 >pdb|1OQ4|A Chain A, The Crystal Structure Of The Complex Between Stearoyl Acyl Carrier Protein Desaturase From Ricinus Communis (Castor Bean) And Azide. gi|31615833|pdb|1OQ4|B Chain B, The Crystal Structure Of The Complex Between Stearoyl Acyl Carrier Protein Desaturase From Ricinus Communis (Castor Bean) And Azide. gi|31615834|pdb|1OQ4|C Chain C, The Crystal Structure Of The Complex Between Stearoyl Acyl Carrier Protein Desaturase From Ricinus Communis (Castor Bean) And Azide. gi|31615835|pdb|1OQ4|D Chain D, The Crystal Structure Of The Complex Between Stearoyl Acyl Carrier Protein Desaturase From Ricinus Communis (Castor Bean) And Azide. gi|31615836|pdb|1OQ4|E Chain E, The Crystal Structure Of The Complex Between Stearoyl Acyl Carrier Protein Desaturase From Ricinus Communis (Castor Bean) And Azide. gi|31615837|pdb|1OQ4|F Chain F, The Crystal Structure Of The Complex Between Stearoyl Acyl Carrier Protein Desaturase From Ricinus Communis (Castor Bean) And Azide. gi|31615838|pdb|1OQ7|A Chain A, The Crystal Structure Of The Iron Free (apo-)form Of Stearoyl Acyl Carrier Protein Desaturase From Ricinus Communis (castor Bean). gi|31615839|pdb|1OQ7|B Chain B, The Crystal Structure Of The Iron Free (apo-)form Of Stearoyl Acyl Carrier Protein Desaturase From Ricinus Communis (castor Bean). gi|31615840|pdb|1OQ7|C Chain C, The Crystal Structure Of The Iron Free (apo-)form Of Stearoyl Acyl Carrier Protein Desaturase From Ricinus Communis (castor Bean). gi|31615841|pdb|1OQ7|D Chain D, The Crystal Structure Of The Iron Free (apo-)form Of Stearoyl Acyl Carrier Protein Desaturase From Ricinus Communis (castor Bean). gi|31615842|pdb|1OQ7|E Chain E, The Crystal Structure Of The Iron Free (apo-)form Of Stearoyl Acyl Carrier Protein Desaturase From Ricinus Communis (castor Bean). gi|31615843|pdb|1OQ7|F Chain F, The Crystal Structure Of The Iron Free (apo-)form Of Stearoyl Acyl Carrier Protein Desaturase From Ricinus Communis (castor Bean). gi|31615844|pdb|1OQ9|A Chain A, The Crystal Structure Of The Complex Between Stearoyl Acyl Carrier Protein Desaturase From Ricinus Communis (Castor Bean) And Acetate. gi|31615845|pdb|1OQB|A Chain A, The Crystal Structure Of The One-iron Form Of The Di-iron Center In Stearoyl Acyl Carrier Protein Desaturase From Ricinus Communis (castor Bean). gi|31615846|pdb|1OQB|B Chain B, The Crystal Structure Of The One-iron Form Of The Di-iron Center In Stearoyl Acyl Carrier Protein Desaturase From Ricinus Communis (castor Bean). gi|31615847|pdb|1OQB|C Chain C, The Crystal Structure Of The One-iron Form Of The Di-iron Center In Stearoyl Acyl Carrier Protein Desaturase From Ricinus Communis (castor Bean). gi|31615848|pdb|1OQB|D Chain D, The Crystal Structure Of The One-iron Form Of The Di-iron Center In Stearoyl Acyl Carrier Protein Desaturase From Ricinus Communis (castor Bean). gi|31615849|pdb|1OQB|E Chain E, The Crystal Structure Of The One-iron Form Of The Di-iron Center In Stearoyl Acyl Carrier Protein Desaturase From Ricinus Communis (castor Bean). gi|31615850|pdb|1OQB|F Chain F, The Crystal Structure Of The One-iron Form Of The Di-iron Center In Stearoyl Acyl Carrier Protein Desaturase From Ricinus Communis (castor Bean). gi|345531619|pdb|2XZ0|A Chain A, The Structure Of The 2:1 (Partially Occupied) Complex Between Stearoyl Acyl Carrier Protein Desaturase From Ricinus Communis (Castor Bean) And Acyl Carrier Protein. gi|345531620|pdb|2XZ0|B Chain B, The Structure Of The 2:1 (Partially Occupied) Complex Between Stearoyl Acyl Carrier Protein Desaturase From Ricinus Communis (Castor Bean) And Acyl Carrier Protein. gi|345531621|pdb|2XZ0|C Chain C, The Structure Of The 2:1 (Partially Occupied) Complex Between Stearoyl Acyl Carrier Protein Desaturase From Ricinus Communis (Castor Bean) And Acyl Carrier Protein. gi|345531623|pdb|2XZ1|A Chain A, The Structure Of The 2:2 (Fully Occupied) Complex Between Stearoyl Acyl Carrier Protein Desaturase From Ricinus Communis (Castor Bean) And Acyl Carrier Protein. gi|345531624|pdb|2XZ1|B Chain B, The Structure Of The 2:2 (Fully Occupied) Complex Between Stearoyl Acyl Carrier Protein Desaturase From Ricinus Communis (Castor Bean) And Acyl Carrier Protein Length = 363 Score = 160 bits (406), Expect = 8e-38 Identities = 77/91 (84%), Positives = 84/91 (92%) Frame = +3 Query: 3 GKDDNLFEHFSAVAQRLQVYTAQDYADILEFLVGRWKVANLTGLSGEGRKAQDYVCGLPP 182 G+DDNLF+HFSAVAQRL VYTA+DYADILEFLVGRWKV LTGLS EG+KAQDYVC LPP Sbjct: 273 GRDDNLFDHFSAVAQRLGVYTAKDYADILEFLVGRWKVDKLTGLSAEGQKAQDYVCRLPP 332 Query: 183 RIRRLQERAQERAKEAGTVPFSWIFDRQIKL 275 RIRRL+ERAQ RAKEA T+PFSWIFDRQ+KL Sbjct: 333 RIRRLEERAQGRAKEAPTMPFSWIFDRQVKL 363 >pdb|2J2F|A Chain A, The T199d Mutant Of Stearoyl Acyl Carrier Protein Desaturase From Ricinus Communis (Castor Bean) gi|118138594|pdb|2J2F|B Chain B, The T199d Mutant Of Stearoyl Acyl Carrier Protein Desaturase From Ricinus Communis (Castor Bean) gi|118138595|pdb|2J2F|C Chain C, The T199d Mutant Of Stearoyl Acyl Carrier Protein Desaturase From Ricinus Communis (Castor Bean) gi|118138596|pdb|2J2F|D Chain D, The T199d Mutant Of Stearoyl Acyl Carrier Protein Desaturase From Ricinus Communis (Castor Bean) gi|118138597|pdb|2J2F|E Chain E, The T199d Mutant Of Stearoyl Acyl Carrier Protein Desaturase From Ricinus Communis (Castor Bean) gi|118138598|pdb|2J2F|F Chain F, The T199d Mutant Of Stearoyl Acyl Carrier Protein Desaturase From Ricinus Communis (Castor Bean) Length = 363 Score = 160 bits (406), Expect = 8e-38 Identities = 77/91 (84%), Positives = 84/91 (92%) Frame = +3 Query: 3 GKDDNLFEHFSAVAQRLQVYTAQDYADILEFLVGRWKVANLTGLSGEGRKAQDYVCGLPP 182 G+DDNLF+HFSAVAQRL VYTA+DYADILEFLVGRWKV LTGLS EG+KAQDYVC LPP Sbjct: 273 GRDDNLFDHFSAVAQRLGVYTAKDYADILEFLVGRWKVDKLTGLSAEGQKAQDYVCRLPP 332 Query: 183 RIRRLQERAQERAKEAGTVPFSWIFDRQIKL 275 RIRRL+ERAQ RAKEA T+PFSWIFDRQ+KL Sbjct: 333 RIRRLEERAQGRAKEAPTMPFSWIFDRQVKL 363