BLASTX nr result
ID: Bupleurum21_contig00007418
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00007418 (1542 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001234214.1| phototropin-1 [Solanum lycopersicum] gi|1511... 131 6e-28 dbj|BAM36551.1| phototropin 1 [Fragaria x ananassa] 130 9e-28 emb|CBI16229.3| unnamed protein product [Vitis vinifera] 130 9e-28 gb|ACQ42250.1| blue light photoreceptor [Fragaria x ananassa] 130 9e-28 ref|XP_002281752.1| PREDICTED: phototropin-1-like [Vitis vinifera] 130 9e-28 >ref|NP_001234214.1| phototropin-1 [Solanum lycopersicum] gi|151176133|gb|ABN42185.2| phototropin-1 [Solanum lycopersicum] Length = 1018 Score = 131 bits (329), Expect = 6e-28 Identities = 58/72 (80%), Positives = 67/72 (93%) Frame = +1 Query: 1 PFRGKTRQRTFANVLQKDIKFPGSKVVSLQAKQLIYRLLHKDPKNRLGAREGANEIKQHP 180 PFRGKTRQ+TF+N+L KD+KFPGS SL AKQL+YRLLH+DPKNRLG+REGANEIKQHP Sbjct: 912 PFRGKTRQKTFSNILHKDLKFPGSIQSSLHAKQLMYRLLHRDPKNRLGSREGANEIKQHP 971 Query: 181 FFRGINWALLRC 216 FFRG+NWAL+RC Sbjct: 972 FFRGVNWALIRC 983 >dbj|BAM36551.1| phototropin 1 [Fragaria x ananassa] Length = 1028 Score = 130 bits (327), Expect = 9e-28 Identities = 58/72 (80%), Positives = 67/72 (93%) Frame = +1 Query: 1 PFRGKTRQRTFANVLQKDIKFPGSKVVSLQAKQLIYRLLHKDPKNRLGAREGANEIKQHP 180 PFRGKTRQ+TFAN+L KD+KFPGS SLQAKQL+YRLLH+DPKNRLG+ EGANEIK+HP Sbjct: 922 PFRGKTRQKTFANILHKDLKFPGSIPASLQAKQLMYRLLHRDPKNRLGSLEGANEIKRHP 981 Query: 181 FFRGINWALLRC 216 FFRG+NWAL+RC Sbjct: 982 FFRGVNWALVRC 993 >emb|CBI16229.3| unnamed protein product [Vitis vinifera] Length = 958 Score = 130 bits (327), Expect = 9e-28 Identities = 58/72 (80%), Positives = 67/72 (93%) Frame = +1 Query: 1 PFRGKTRQRTFANVLQKDIKFPGSKVVSLQAKQLIYRLLHKDPKNRLGAREGANEIKQHP 180 PFRGKTRQ+TFAN+L KD+KFP S VSL AKQL+YRLLH+DPKNRLG+REGANEIK+HP Sbjct: 852 PFRGKTRQKTFANILHKDLKFPSSISVSLNAKQLMYRLLHRDPKNRLGSREGANEIKRHP 911 Query: 181 FFRGINWALLRC 216 FFRG+NWAL+RC Sbjct: 912 FFRGVNWALVRC 923 >gb|ACQ42250.1| blue light photoreceptor [Fragaria x ananassa] Length = 642 Score = 130 bits (327), Expect = 9e-28 Identities = 58/72 (80%), Positives = 67/72 (93%) Frame = +1 Query: 1 PFRGKTRQRTFANVLQKDIKFPGSKVVSLQAKQLIYRLLHKDPKNRLGAREGANEIKQHP 180 PFRGKTRQ+TFAN+L KD+KFPGS SLQAKQL+YRLLH+DPKNRLG+ EGANEIK+HP Sbjct: 536 PFRGKTRQKTFANILHKDLKFPGSIPASLQAKQLMYRLLHRDPKNRLGSLEGANEIKRHP 595 Query: 181 FFRGINWALLRC 216 FFRG+NWAL+RC Sbjct: 596 FFRGVNWALVRC 607 >ref|XP_002281752.1| PREDICTED: phototropin-1-like [Vitis vinifera] Length = 1004 Score = 130 bits (327), Expect = 9e-28 Identities = 58/72 (80%), Positives = 67/72 (93%) Frame = +1 Query: 1 PFRGKTRQRTFANVLQKDIKFPGSKVVSLQAKQLIYRLLHKDPKNRLGAREGANEIKQHP 180 PFRGKTRQ+TFAN+L KD+KFP S VSL AKQL+YRLLH+DPKNRLG+REGANEIK+HP Sbjct: 898 PFRGKTRQKTFANILHKDLKFPSSISVSLNAKQLMYRLLHRDPKNRLGSREGANEIKRHP 957 Query: 181 FFRGINWALLRC 216 FFRG+NWAL+RC Sbjct: 958 FFRGVNWALVRC 969