BLASTX nr result
ID: Bupleurum21_contig00007318
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00007318 (357 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002274054.1| PREDICTED: uncharacterized protein LOC100265... 65 7e-09 ref|XP_002509508.1| conserved hypothetical protein [Ricinus comm... 63 3e-08 ref|XP_002304685.1| predicted protein [Populus trichocarpa] gi|2... 61 8e-08 ref|XP_002297842.1| predicted protein [Populus trichocarpa] gi|1... 61 8e-08 ref|XP_002514909.1| conserved hypothetical protein [Ricinus comm... 60 1e-07 >ref|XP_002274054.1| PREDICTED: uncharacterized protein LOC100265182 [Vitis vinifera] Length = 282 Score = 64.7 bits (156), Expect = 7e-09 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = -1 Query: 108 YATSRVVPQQSFAEIKVSFDVLLSQAPCNFLVFGLG 1 YATSRVVPQQS AEI+VSFDVL S APCNFLV+GLG Sbjct: 68 YATSRVVPQQSLAEIRVSFDVLQSLAPCNFLVYGLG 103 >ref|XP_002509508.1| conserved hypothetical protein [Ricinus communis] gi|223549407|gb|EEF50895.1| conserved hypothetical protein [Ricinus communis] Length = 298 Score = 62.8 bits (151), Expect = 3e-08 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = -1 Query: 108 YATSRVVPQQSFAEIKVSFDVLLSQAPCNFLVFGLG 1 YATSRVVPQQS AEI +SFDVL S APCNFLVFGLG Sbjct: 81 YATSRVVPQQSRAEISLSFDVLQSLAPCNFLVFGLG 116 >ref|XP_002304685.1| predicted protein [Populus trichocarpa] gi|222842117|gb|EEE79664.1| predicted protein [Populus trichocarpa] Length = 285 Score = 61.2 bits (147), Expect = 8e-08 Identities = 27/36 (75%), Positives = 33/36 (91%) Frame = -1 Query: 108 YATSRVVPQQSFAEIKVSFDVLLSQAPCNFLVFGLG 1 YATS++VPQQS AEI V+FDVL +++PCNFLVFGLG Sbjct: 70 YATSKIVPQQSLAEISVTFDVLKTRSPCNFLVFGLG 105 >ref|XP_002297842.1| predicted protein [Populus trichocarpa] gi|118483182|gb|ABK93495.1| unknown [Populus trichocarpa] gi|222845100|gb|EEE82647.1| predicted protein [Populus trichocarpa] Length = 285 Score = 61.2 bits (147), Expect = 8e-08 Identities = 27/36 (75%), Positives = 33/36 (91%) Frame = -1 Query: 108 YATSRVVPQQSFAEIKVSFDVLLSQAPCNFLVFGLG 1 YATS++VPQQS AEI V+FDVL +++PCNFLVFGLG Sbjct: 70 YATSKIVPQQSLAEISVTFDVLKTRSPCNFLVFGLG 105 >ref|XP_002514909.1| conserved hypothetical protein [Ricinus communis] gi|223545960|gb|EEF47463.1| conserved hypothetical protein [Ricinus communis] Length = 285 Score = 60.5 bits (145), Expect = 1e-07 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = -1 Query: 108 YATSRVVPQQSFAEIKVSFDVLLSQAPCNFLVFGLG 1 YATSRVVPQQS EI V+F+VL S APCNFLVFGLG Sbjct: 70 YATSRVVPQQSLGEISVTFNVLKSLAPCNFLVFGLG 105