BLASTX nr result
ID: Bupleurum21_contig00007289
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00007289 (557 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526240.1| conserved hypothetical protein [Ricinus comm... 55 6e-06 >ref|XP_002526240.1| conserved hypothetical protein [Ricinus communis] gi|223534434|gb|EEF36137.1| conserved hypothetical protein [Ricinus communis] Length = 393 Score = 55.5 bits (132), Expect = 6e-06 Identities = 39/113 (34%), Positives = 62/113 (54%), Gaps = 5/113 (4%) Frame = -1 Query: 326 SNDDLLAKILSGFSVRSLICLKLVSKQWISFVTSKALSII-----PSRRTTAIFLQFDNG 162 SN+DL+ +IL V+ L+ K VSKQW+S +++ S + P+ +A+FL+ Sbjct: 12 SNEDLITQILLRLPVKPLLRFKSVSKQWLSLISTPHFSSLHTLRNPNHTISALFLR---N 68 Query: 161 TTSRTKFLHLDPNSVNNSRLDNSECRSVSADDPFRSDNVRYLQSCHGLLLCRT 3 + KFL S+++S +S S + D F ++ LQSC+GLLLC T Sbjct: 69 SPLEFKFL-----SLSSSSSSSSSSASPLSFDLFH--GIKILQSCNGLLLCST 114