BLASTX nr result
ID: Bupleurum21_contig00007256
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00007256 (531 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004134418.1| PREDICTED: putative SWI/SNF-related matrix-a... 74 1e-11 emb|CBI23583.3| unnamed protein product [Vitis vinifera] 71 1e-10 ref|XP_002280814.1| PREDICTED: putative SWI/SNF-related matrix-a... 71 1e-10 emb|CAN71217.1| hypothetical protein VITISV_033485 [Vitis vinifera] 71 1e-10 ref|XP_002529311.1| DNA repair helicase rad5,16, putative [Ricin... 68 7e-10 >ref|XP_004134418.1| PREDICTED: putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 3-like [Cucumis sativus] gi|449523563|ref|XP_004168793.1| PREDICTED: putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 3-like [Cucumis sativus] Length = 1113 Score = 74.3 bits (181), Expect = 1e-11 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = -3 Query: 205 IGRLPMEWAKCLILLVNSSKVKVLCRCIAAPSNLQLMQEILLY 77 IGRLPMEWAKC++ LVNS KVK+L RCIAAP NL +MQEILLY Sbjct: 287 IGRLPMEWAKCVVPLVNSQKVKILGRCIAAPGNLHIMQEILLY 329 >emb|CBI23583.3| unnamed protein product [Vitis vinifera] Length = 1287 Score = 70.9 bits (172), Expect = 1e-10 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = -3 Query: 205 IGRLPMEWAKCLILLVNSSKVKVLCRCIAAPSNLQLMQEILLY 77 IGRLPMEW KC+I LVNSSKVKVL RC+AAP L+LMQEI+LY Sbjct: 391 IGRLPMEWTKCIIPLVNSSKVKVLGRCVAAPIILRLMQEIVLY 433 >ref|XP_002280814.1| PREDICTED: putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 3-like [Vitis vinifera] Length = 1224 Score = 70.9 bits (172), Expect = 1e-10 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = -3 Query: 205 IGRLPMEWAKCLILLVNSSKVKVLCRCIAAPSNLQLMQEILLY 77 IGRLPMEW KC+I LVNSSKVKVL RC+AAP L+LMQEI+LY Sbjct: 391 IGRLPMEWTKCIIPLVNSSKVKVLGRCVAAPIILRLMQEIVLY 433 >emb|CAN71217.1| hypothetical protein VITISV_033485 [Vitis vinifera] Length = 1249 Score = 70.9 bits (172), Expect = 1e-10 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = -3 Query: 205 IGRLPMEWAKCLILLVNSSKVKVLCRCIAAPSNLQLMQEILLY 77 IGRLPMEW KC+I LVNSSKVKVL RC+AAP L+LMQEI+LY Sbjct: 391 IGRLPMEWTKCIIPLVNSSKVKVLGRCVAAPIILRLMQEIVLY 433 >ref|XP_002529311.1| DNA repair helicase rad5,16, putative [Ricinus communis] gi|223531235|gb|EEF33080.1| DNA repair helicase rad5,16, putative [Ricinus communis] Length = 1051 Score = 68.2 bits (165), Expect = 7e-10 Identities = 31/43 (72%), Positives = 36/43 (83%) Frame = -3 Query: 205 IGRLPMEWAKCLILLVNSSKVKVLCRCIAAPSNLQLMQEILLY 77 IGRLPMEW KC++ LVNS+KVK L RCIAAP L +MQEI+LY Sbjct: 240 IGRLPMEWGKCVVPLVNSNKVKFLGRCIAAPPTLHIMQEIMLY 282