BLASTX nr result
ID: Bupleurum21_contig00007234
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00007234 (425 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002284120.1| PREDICTED: probable thylakoidal processing p... 62 6e-08 >ref|XP_002284120.1| PREDICTED: probable thylakoidal processing peptidase 2, chloroplastic [Vitis vinifera] gi|147810057|emb|CAN78280.1| hypothetical protein VITISV_021649 [Vitis vinifera] Length = 368 Score = 61.6 bits (148), Expect = 6e-08 Identities = 31/52 (59%), Positives = 36/52 (69%), Gaps = 3/52 (5%) Frame = +2 Query: 278 KGGTSC---RGFAGRCDGMDFERSNWLSKLLNCCSDDAKAAFTAVSVHILFR 424 KGGT C + D ERSNWLSKLLNCCS+DA+A FTAV+V +LFR Sbjct: 152 KGGTQCCDVEVISKPLDRKVLERSNWLSKLLNCCSEDARAVFTAVTVSLLFR 203