BLASTX nr result
ID: Bupleurum21_contig00007176
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00007176 (357 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004135848.1| PREDICTED: DUF246 domain-containing protein ... 119 2e-25 ref|XP_002894391.1| hypothetical protein ARALYDRAFT_474388 [Arab... 119 3e-25 ref|NP_175672.2| O-fucosyltransferase family protein [Arabidopsi... 117 7e-25 ref|XP_002517611.1| conserved hypothetical protein [Ricinus comm... 117 1e-24 ref|XP_003533064.1| PREDICTED: DUF246 domain-containing protein ... 115 4e-24 >ref|XP_004135848.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis sativus] gi|449530766|ref|XP_004172363.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis sativus] Length = 441 Score = 119 bits (299), Expect = 2e-25 Identities = 54/64 (84%), Positives = 58/64 (90%), Gaps = 3/64 (4%) Frame = +2 Query: 173 SDIWSVRRIVEWRPCDWWLRGHLNE---ESNGYIRVDCYGGLNQMRRDLCDGVGVARLLN 343 +DIWSVRRIVEWRPC WWLRGHL ++NGYIRVDCYGGLNQMRRDLCDGVG+ARLLN Sbjct: 47 TDIWSVRRIVEWRPCKWWLRGHLPALPADTNGYIRVDCYGGLNQMRRDLCDGVGIARLLN 106 Query: 344 ATLV 355 ATLV Sbjct: 107 ATLV 110 >ref|XP_002894391.1| hypothetical protein ARALYDRAFT_474388 [Arabidopsis lyrata subsp. lyrata] gi|297340233|gb|EFH70650.1| hypothetical protein ARALYDRAFT_474388 [Arabidopsis lyrata subsp. lyrata] Length = 438 Score = 119 bits (297), Expect = 3e-25 Identities = 53/67 (79%), Positives = 59/67 (88%), Gaps = 3/67 (4%) Frame = +2 Query: 164 TANSDIWSVRRIVEWRPCDWWLRGHLNE---ESNGYIRVDCYGGLNQMRRDLCDGVGVAR 334 + SDIWSV+RIVEWRPC WWL+GHL ++NGYIRVDCYGGLNQMRRDLCDGVG+AR Sbjct: 41 SVGSDIWSVKRIVEWRPCKWWLQGHLTPLPAKTNGYIRVDCYGGLNQMRRDLCDGVGIAR 100 Query: 335 LLNATLV 355 LLNATLV Sbjct: 101 LLNATLV 107 >ref|NP_175672.2| O-fucosyltransferase family protein [Arabidopsis thaliana] gi|18491205|gb|AAL69505.1| unknown protein [Arabidopsis thaliana] gi|20465295|gb|AAM20051.1| unknown protein [Arabidopsis thaliana] gi|332194710|gb|AEE32831.1| O-fucosyltransferase family protein [Arabidopsis thaliana] Length = 439 Score = 117 bits (294), Expect = 7e-25 Identities = 52/65 (80%), Positives = 59/65 (90%), Gaps = 3/65 (4%) Frame = +2 Query: 170 NSDIWSVRRIVEWRPCDWWLRGHLNE---ESNGYIRVDCYGGLNQMRRDLCDGVGVARLL 340 +SDIWSV+RI+EWRPC WWL+GHL ++NGYIRVDCYGGLNQMRRDLCDGVG+ARLL Sbjct: 44 SSDIWSVKRIMEWRPCKWWLQGHLTPLPAKTNGYIRVDCYGGLNQMRRDLCDGVGIARLL 103 Query: 341 NATLV 355 NATLV Sbjct: 104 NATLV 108 >ref|XP_002517611.1| conserved hypothetical protein [Ricinus communis] gi|223543243|gb|EEF44775.1| conserved hypothetical protein [Ricinus communis] Length = 441 Score = 117 bits (292), Expect = 1e-24 Identities = 52/70 (74%), Positives = 61/70 (87%), Gaps = 4/70 (5%) Frame = +2 Query: 158 TFTANS-DIWSVRRIVEWRPCDWWLRGHLNE---ESNGYIRVDCYGGLNQMRRDLCDGVG 325 ++T S DIWSV+R++EWRPC WWL+GHL+ ESNGY+RVDCYGGLNQMRRD CDGVG Sbjct: 43 SYTGKSLDIWSVKRVLEWRPCKWWLQGHLSALPAESNGYVRVDCYGGLNQMRRDFCDGVG 102 Query: 326 VARLLNATLV 355 +ARLLNATLV Sbjct: 103 IARLLNATLV 112 >ref|XP_003533064.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Glycine max] Length = 440 Score = 115 bits (288), Expect = 4e-24 Identities = 51/63 (80%), Positives = 57/63 (90%), Gaps = 3/63 (4%) Frame = +2 Query: 176 DIWSVRRIVEWRPCDWWLRGH---LNEESNGYIRVDCYGGLNQMRRDLCDGVGVARLLNA 346 DIWSVRR+VEWRPC+WWL+GH L ++NGYIRVDCYGGLNQMRRD CDGVG+ARLLNA Sbjct: 47 DIWSVRRLVEWRPCNWWLQGHQTALPLQTNGYIRVDCYGGLNQMRRDFCDGVGIARLLNA 106 Query: 347 TLV 355 TLV Sbjct: 107 TLV 109