BLASTX nr result
ID: Bupleurum21_contig00007056
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00007056 (431 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002524666.1| Cytochrome c oxidase polypeptide Vc-2, putat... 66 3e-14 ref|NP_001119340.1| putative cytochrome c oxidase subunit 5C-4 [... 70 6e-14 ref|XP_002868657.1| hypothetical protein ARALYDRAFT_493950 [Arab... 71 1e-13 sp|P19173.3|COX5C_IPOBA RecName: Full=Cytochrome c oxidase subun... 64 2e-11 gb|ACG39497.1| cytochrome c oxidase polypeptide Vc [Zea mays] 67 3e-11 >ref|XP_002524666.1| Cytochrome c oxidase polypeptide Vc-2, putative [Ricinus communis] gi|223536027|gb|EEF37685.1| Cytochrome c oxidase polypeptide Vc-2, putative [Ricinus communis] Length = 65 Score = 66.2 bits (160), Expect(2) = 3e-14 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -2 Query: 226 LTAGGLWKMHHWNNQKRTREFYNLLDKGVISVVVEDE 116 L AG LWKMHHWNNQKR +EFY+LL++G ISVVVEDE Sbjct: 29 LGAGLLWKMHHWNNQKRAKEFYDLLERGEISVVVEDE 65 Score = 37.0 bits (84), Expect(2) = 3e-14 Identities = 17/28 (60%), Positives = 22/28 (78%) Frame = -1 Query: 311 MGAAQKIGHVAYQGGPSVIKEIVIGIAL 228 M AA+K+ H AY G PS+IKEI+ GI+L Sbjct: 1 MAAARKVAHAAYNG-PSIIKEIIYGISL 27 >ref|NP_001119340.1| putative cytochrome c oxidase subunit 5C-4 [Arabidopsis thaliana] gi|48428152|sp|Q9FNE0.1|CX5C4_ARATH RecName: Full=Putative cytochrome c oxidase subunit 5C-4; AltName: Full=Cytochrome c oxidase polypeptide Vc-4 gi|10178149|dbj|BAB11594.1| cytochrome c oxidase Vc subunit [Arabidopsis thaliana] gi|332007158|gb|AED94541.1| putative cytochrome c oxidase subunit 5C-4 [Arabidopsis thaliana] Length = 65 Score = 69.7 bits (169), Expect(2) = 6e-14 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -2 Query: 217 GGLWKMHHWNNQKRTREFYNLLDKGVISVVVEDE 116 GGLWKMHHWNNQ+RT+EFY+LL+KG ISVVVEDE Sbjct: 32 GGLWKMHHWNNQRRTKEFYDLLEKGEISVVVEDE 65 Score = 32.3 bits (72), Expect(2) = 6e-14 Identities = 16/28 (57%), Positives = 19/28 (67%) Frame = -1 Query: 311 MGAAQKIGHVAYQGGPSVIKEIVIGIAL 228 M QKIG Y+G PSV+KEI+ GI L Sbjct: 1 MANVQKIGKAVYKG-PSVVKEIIYGITL 27 >ref|XP_002868657.1| hypothetical protein ARALYDRAFT_493950 [Arabidopsis lyrata subsp. lyrata] gi|297314493|gb|EFH44916.1| hypothetical protein ARALYDRAFT_493950 [Arabidopsis lyrata subsp. lyrata] Length = 65 Score = 71.2 bits (173), Expect(2) = 1e-13 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = -2 Query: 226 LTAGGLWKMHHWNNQKRTREFYNLLDKGVISVVVEDE 116 L GGLWKMHHWNNQ+RT+EFY+LL+KG ISVVVEDE Sbjct: 29 LAVGGLWKMHHWNNQRRTKEFYDLLEKGEISVVVEDE 65 Score = 30.0 bits (66), Expect(2) = 1e-13 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -1 Query: 311 MGAAQKIGHVAYQGGPSVIKEIVIGIAL 228 M KIG Y+G PSV+KEI+ GI L Sbjct: 1 MANVPKIGKAVYKG-PSVVKEIIYGITL 27 >sp|P19173.3|COX5C_IPOBA RecName: Full=Cytochrome c oxidase subunit 5C; AltName: Full=Cytochrome c oxidase polypeptide Vc gi|58368|emb|CAA37470.1| unnamed protein product [Ipomoea batatas] gi|688313|gb|AAB31231.1| cytochrome c oxidase subunit Vc [Ipomoea batatas] Length = 64 Score = 64.3 bits (155), Expect(2) = 2e-11 Identities = 25/37 (67%), Positives = 33/37 (89%) Frame = -2 Query: 226 LTAGGLWKMHHWNNQKRTREFYNLLDKGVISVVVEDE 116 L AGG WKMHHWN+Q+RT+EFY++L+KG ISVV ++E Sbjct: 28 LVAGGFWKMHHWNSQRRTKEFYDMLEKGQISVVADEE 64 Score = 29.3 bits (64), Expect(2) = 2e-11 Identities = 13/26 (50%), Positives = 19/26 (73%) Frame = -1 Query: 305 AAQKIGHVAYQGGPSVIKEIVIGIAL 228 A + H+ Y+G PSV+KE+VIG +L Sbjct: 2 AGGHVAHLVYKG-PSVVKELVIGFSL 26 >gb|ACG39497.1| cytochrome c oxidase polypeptide Vc [Zea mays] Length = 77 Score = 67.0 bits (162), Expect(2) = 3e-11 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = -2 Query: 226 LTAGGLWKMHHWNNQKRTREFYNLLDKGVISVVVEDE 116 L AGG+WKMHHWN Q++TR FY++LDKG ISVVVED+ Sbjct: 28 LIAGGMWKMHHWNEQRKTRSFYDMLDKGQISVVVEDQ 64 Score = 26.2 bits (56), Expect(2) = 3e-11 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = -1 Query: 305 AAQKIGHVAYQGGPSVIKEIVIGIAL 228 A ++ H +G PSV+KEI IG+ L Sbjct: 2 AGGRVAHATLKG-PSVVKEIFIGLTL 26