BLASTX nr result
ID: Bupleurum21_contig00007002
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00007002 (542 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFW58868.1| hypothetical protein ZEAMMB73_850141 [Zea mays] 67 2e-09 ref|NP_001131740.1| uncharacterized protein LOC100193106 [Zea ma... 67 2e-09 ref|XP_004146504.1| PREDICTED: probable small nuclear ribonucleo... 66 3e-09 tpg|DAA36915.1| TPA: hypothetical protein ZEAMMB73_879106 [Zea m... 66 3e-09 ref|XP_003565149.1| PREDICTED: probable small nuclear ribonucleo... 66 3e-09 >gb|AFW58868.1| hypothetical protein ZEAMMB73_850141 [Zea mays] Length = 104 Score = 66.6 bits (161), Expect = 2e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 540 NKKLLGRVRAFDRHCNMVLENVREMWTELP 451 NKKLLGRVRAFDRHCNMVLENVREMWTE+P Sbjct: 39 NKKLLGRVRAFDRHCNMVLENVREMWTEIP 68 >ref|NP_001131740.1| uncharacterized protein LOC100193106 [Zea mays] gi|194692396|gb|ACF80282.1| unknown [Zea mays] gi|195629728|gb|ACG36505.1| small nuclear ribonucleoprotein Sm D2 [Zea mays] gi|413918934|gb|AFW58866.1| Small nuclear ribonucleoprotein Sm D2 isoform 1 [Zea mays] gi|413918935|gb|AFW58867.1| Small nuclear ribonucleoprotein Sm D2 isoform 2 [Zea mays] Length = 105 Score = 66.6 bits (161), Expect = 2e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 540 NKKLLGRVRAFDRHCNMVLENVREMWTELP 451 NKKLLGRVRAFDRHCNMVLENVREMWTE+P Sbjct: 40 NKKLLGRVRAFDRHCNMVLENVREMWTEIP 69 >ref|XP_004146504.1| PREDICTED: probable small nuclear ribonucleoprotein Sm D2-like [Cucumis sativus] gi|449499984|ref|XP_004160970.1| PREDICTED: probable small nuclear ribonucleoprotein Sm D2-like [Cucumis sativus] Length = 107 Score = 66.2 bits (160), Expect = 3e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 540 NKKLLGRVRAFDRHCNMVLENVREMWTELP 451 NKKLLGRVRAFDRHCNMVLENVREMWTE+P Sbjct: 42 NKKLLGRVRAFDRHCNMVLENVREMWTEVP 71 >tpg|DAA36915.1| TPA: hypothetical protein ZEAMMB73_879106 [Zea mays] Length = 102 Score = 66.2 bits (160), Expect = 3e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 540 NKKLLGRVRAFDRHCNMVLENVREMWTELP 451 NKKLLGRVRAFDRHCNMVLENVREMWTE+P Sbjct: 37 NKKLLGRVRAFDRHCNMVLENVREMWTEVP 66 >ref|XP_003565149.1| PREDICTED: probable small nuclear ribonucleoprotein Sm D2-like isoform 1 [Brachypodium distachyon] gi|357126950|ref|XP_003565150.1| PREDICTED: probable small nuclear ribonucleoprotein Sm D2-like isoform 2 [Brachypodium distachyon] Length = 105 Score = 66.2 bits (160), Expect = 3e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 540 NKKLLGRVRAFDRHCNMVLENVREMWTELP 451 NKKLLGRVRAFDRHCNMVLENVREMWTE+P Sbjct: 40 NKKLLGRVRAFDRHCNMVLENVREMWTEVP 69