BLASTX nr result
ID: Bupleurum21_contig00005885
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00005885 (524 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002266484.2| PREDICTED: uncharacterized protein LOC100246... 51 8e-06 >ref|XP_002266484.2| PREDICTED: uncharacterized protein LOC100246465, partial [Vitis vinifera] Length = 344 Score = 51.2 bits (121), Expect(2) = 8e-06 Identities = 23/39 (58%), Positives = 27/39 (69%) Frame = +1 Query: 196 MVILCCMEVVGGVLLLPWAKTENILGYIDHRRRQHQCIQ 312 MV+LC M++VG + PW KT N Y DHRRRQHQC Q Sbjct: 1 MVVLCWMDLVGD--MAPWTKTRNKWYYFDHRRRQHQCTQ 37 Score = 23.1 bits (48), Expect(2) = 8e-06 Identities = 15/45 (33%), Positives = 19/45 (42%) Frame = +3 Query: 390 YCKISPIXXXXXXXXXXXXXXXXXXXXKPHDIQQANQTFQSGKEL 524 YCKISPI + + ANQTF+ G+EL Sbjct: 58 YCKISPIIPIFVSFLLVASSVCSVHSSETD--RPANQTFRPGEEL 100