BLASTX nr result
ID: Bupleurum21_contig00005787
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00005787 (387 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002310982.1| predicted protein [Populus trichocarpa] gi|2... 55 6e-06 ref|XP_002524081.1| conserved hypothetical protein [Ricinus comm... 55 8e-06 >ref|XP_002310982.1| predicted protein [Populus trichocarpa] gi|222850802|gb|EEE88349.1| predicted protein [Populus trichocarpa] Length = 707 Score = 55.1 bits (131), Expect = 6e-06 Identities = 24/36 (66%), Positives = 27/36 (75%) Frame = +3 Query: 273 QMKSFIGFFHPDEMEEGRFDFLHGTMFFDPQSIEVN 380 Q KSFIGFFHP+ +EEG FDFLHG M FD E+N Sbjct: 520 QEKSFIGFFHPEGLEEGDFDFLHGAMSFDSMRQEIN 555 >ref|XP_002524081.1| conserved hypothetical protein [Ricinus communis] gi|223536649|gb|EEF38291.1| conserved hypothetical protein [Ricinus communis] Length = 773 Score = 54.7 bits (130), Expect = 8e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +3 Query: 279 KSFIGFFHPDEMEEGRFDFLHGTMFFD 359 KSFIGFFHPD M+EGRFDFLHG M FD Sbjct: 539 KSFIGFFHPDGMDEGRFDFLHGAMSFD 565