BLASTX nr result
ID: Bupleurum21_contig00005767
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00005767 (343 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002310966.1| predicted protein [Populus trichocarpa] gi|2... 59 3e-07 ref|XP_002310967.1| predicted protein [Populus trichocarpa] gi|2... 59 4e-07 ref|XP_003619177.1| 3-oxo-5-alpha-steroid 4-dehydrogenase [Medic... 58 7e-07 ref|NP_197105.1| 3-oxo-5-alpha-steroid 4-dehydrogenase family pr... 58 9e-07 ref|XP_003518596.1| PREDICTED: trans-2,3-enoyl-CoA reductase-lik... 58 9e-07 >ref|XP_002310966.1| predicted protein [Populus trichocarpa] gi|222850786|gb|EEE88333.1| predicted protein [Populus trichocarpa] Length = 267 Score = 59.3 bits (142), Expect = 3e-07 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = +3 Query: 3 LGRSYATKKWYLSKFDDFPKNVKCLIPYVF 92 +GRSYAT++WYLSKF+DFPK+VK LIPYVF Sbjct: 238 MGRSYATRRWYLSKFEDFPKDVKALIPYVF 267 >ref|XP_002310967.1| predicted protein [Populus trichocarpa] gi|222850787|gb|EEE88334.1| predicted protein [Populus trichocarpa] Length = 269 Score = 58.9 bits (141), Expect = 4e-07 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = +3 Query: 3 LGRSYATKKWYLSKFDDFPKNVKCLIPYVF 92 +GRSYAT++WYL+KFDDFPK+VK +IPYVF Sbjct: 240 MGRSYATRRWYLTKFDDFPKDVKAIIPYVF 269 >ref|XP_003619177.1| 3-oxo-5-alpha-steroid 4-dehydrogenase [Medicago truncatula] gi|355494192|gb|AES75395.1| 3-oxo-5-alpha-steroid 4-dehydrogenase [Medicago truncatula] Length = 270 Score = 58.2 bits (139), Expect = 7e-07 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +3 Query: 3 LGRSYATKKWYLSKFDDFPKNVKCLIPYVF 92 LGRSYAT++WYLSKFDDFPKNVK +IP+ F Sbjct: 241 LGRSYATREWYLSKFDDFPKNVKAIIPFWF 270 >ref|NP_197105.1| 3-oxo-5-alpha-steroid 4-dehydrogenase family protein [Arabidopsis thaliana] gi|14190513|gb|AAK55737.1|AF380656_1 AT5g16010/F1N13_150 [Arabidopsis thaliana] gi|9755647|emb|CAC01800.1| steroid 5alpha-reductase-like protein [Arabidopsis thaliana] gi|24797018|gb|AAN64521.1| At5g16010/F1N13_150 [Arabidopsis thaliana] gi|332004851|gb|AED92234.1| 3-oxo-5-alpha-steroid 4-dehydrogenase family protein [Arabidopsis thaliana] Length = 268 Score = 57.8 bits (138), Expect = 9e-07 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = +3 Query: 3 LGRSYATKKWYLSKFDDFPKNVKCLIPYVF 92 +GRSYAT+ WYLSKFDDFPK++K LIP+VF Sbjct: 239 IGRSYATRTWYLSKFDDFPKHIKALIPFVF 268 >ref|XP_003518596.1| PREDICTED: trans-2,3-enoyl-CoA reductase-like [Glycine max] Length = 266 Score = 57.8 bits (138), Expect = 9e-07 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = +3 Query: 3 LGRSYATKKWYLSKFDDFPKNVKCLIPYVF 92 LGRSY+T+KWYLSKF+DFPK+VK +IP+VF Sbjct: 237 LGRSYSTRKWYLSKFEDFPKDVKAIIPFVF 266