BLASTX nr result
ID: Bupleurum21_contig00005621
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00005621 (291 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK40800.1| unknown [Medicago truncatula] 79 3e-13 gb|ABE11612.1| SWIb domain-containing protein [Solanum chacoense] 79 5e-13 ref|XP_003551777.1| PREDICTED: upstream activation factor subuni... 78 7e-13 ref|NP_001236050.1| uncharacterized protein LOC100527179 [Glycin... 78 7e-13 ref|XP_002277738.1| PREDICTED: upstream activation factor subuni... 74 1e-11 >gb|AFK40800.1| unknown [Medicago truncatula] Length = 100 Score = 79.3 bits (194), Expect = 3e-13 Identities = 34/42 (80%), Positives = 39/42 (92%) Frame = +2 Query: 2 DPKNKNIVNCDDKLKSILLGKPQIELAELPVLIKLHFPKEPQ 127 DP NKN+VNCD+KLK ILLGKPQ++LAELP LIKLHFPKEP+ Sbjct: 59 DPNNKNVVNCDEKLKGILLGKPQVDLAELPALIKLHFPKEPK 100 >gb|ABE11612.1| SWIb domain-containing protein [Solanum chacoense] Length = 100 Score = 78.6 bits (192), Expect = 5e-13 Identities = 33/42 (78%), Positives = 39/42 (92%) Frame = +2 Query: 2 DPKNKNIVNCDDKLKSILLGKPQIELAELPVLIKLHFPKEPQ 127 DP NKN+VNCD+KLKS+LLGKPQ+EL ELP LIKLHFPK+P+ Sbjct: 59 DPNNKNLVNCDEKLKSVLLGKPQVELTELPTLIKLHFPKQPR 100 >ref|XP_003551777.1| PREDICTED: upstream activation factor subunit spp27-like [Glycine max] Length = 100 Score = 78.2 bits (191), Expect = 7e-13 Identities = 34/42 (80%), Positives = 39/42 (92%) Frame = +2 Query: 2 DPKNKNIVNCDDKLKSILLGKPQIELAELPVLIKLHFPKEPQ 127 D NKN+VNCD+KLKSILLGKPQ+ELAELP LIK+HFPKEP+ Sbjct: 59 DQNNKNVVNCDEKLKSILLGKPQVELAELPALIKMHFPKEPK 100 >ref|NP_001236050.1| uncharacterized protein LOC100527179 [Glycine max] gi|255631726|gb|ACU16230.1| unknown [Glycine max] Length = 100 Score = 78.2 bits (191), Expect = 7e-13 Identities = 34/42 (80%), Positives = 39/42 (92%) Frame = +2 Query: 2 DPKNKNIVNCDDKLKSILLGKPQIELAELPVLIKLHFPKEPQ 127 D NKN+VNCD+KLKSILLGKPQ+ELAELP LIK+HFPKEP+ Sbjct: 59 DQNNKNVVNCDEKLKSILLGKPQVELAELPALIKMHFPKEPK 100 >ref|XP_002277738.1| PREDICTED: upstream activation factor subunit UAF30 [Vitis vinifera] gi|297737490|emb|CBI26691.3| unnamed protein product [Vitis vinifera] Length = 100 Score = 74.3 bits (181), Expect = 1e-11 Identities = 33/40 (82%), Positives = 37/40 (92%) Frame = +2 Query: 2 DPKNKNIVNCDDKLKSILLGKPQIELAELPVLIKLHFPKE 121 DP NKN+V CDDKL+SILLGKP++ELAELP LIKLHFPKE Sbjct: 59 DPNNKNVVICDDKLRSILLGKPRVELAELPALIKLHFPKE 98