BLASTX nr result
ID: Bupleurum21_contig00005277
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00005277 (256 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAK19069.1| late elongated hypocotyl homolog [Ipomoea nil] 59 4e-07 >dbj|BAK19069.1| late elongated hypocotyl homolog [Ipomoea nil] Length = 776 Score = 58.9 bits (141), Expect = 4e-07 Identities = 33/84 (39%), Positives = 45/84 (53%) Frame = -3 Query: 254 SNNEREVNSPVLAFVDQQLDPKCSRTSPQQCLGVESPPLSTSKSAEGERENMNTELCTVD 75 +NNERE +P + QQLDP C+ T +Q + P L +S S E + +NT + D Sbjct: 481 ANNEREDGTPDPSLHVQQLDPGCTETLREQLSASKPPVLCSSDSEESDGMKVNTTVTVTD 540 Query: 74 PEQVIAVTKAQDCKKMKNQKLVDR 3 EQ VT+ D KN+K VDR Sbjct: 541 TEQAAIVTELIDSNTTKNRKQVDR 564