BLASTX nr result
ID: Bupleurum21_contig00005100
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00005100 (410 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002512923.1| hypothetical protein RCOM_1447500 [Ricinus c... 57 2e-06 >ref|XP_002512923.1| hypothetical protein RCOM_1447500 [Ricinus communis] gi|223547934|gb|EEF49426.1| hypothetical protein RCOM_1447500 [Ricinus communis] Length = 718 Score = 57.0 bits (136), Expect = 2e-06 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 1/61 (1%) Frame = +1 Query: 10 PQLTGARKQGVQLQLL-SSSDGDGNDNAQDVSVAQVVSKNESSADTDTMDTDKIKEKHLS 186 P L KQGV+LQ L SS+D + +N +++ + V KNESSA+TDTMD D ++ HLS Sbjct: 391 PDLAFNVKQGVKLQSLDSSTDSEAKENIENIHTSAVNLKNESSAETDTMDMDTLRVNHLS 450 Query: 187 G 189 G Sbjct: 451 G 451