BLASTX nr result
ID: Bupleurum21_contig00004983
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00004983 (475 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAC98494.1| AG-motif binding protein-4 [Nicotiana tabacum] 62 4e-08 >dbj|BAC98494.1| AG-motif binding protein-4 [Nicotiana tabacum] Length = 326 Score = 62.4 bits (150), Expect = 4e-08 Identities = 32/57 (56%), Positives = 41/57 (71%) Frame = -2 Query: 348 MEARALKTSFLSEVAMKTTTQQVFFDDVWCVTGINNVSAXXXXXXXXXXXXDKEFKE 178 +EARALK+SFLS++AMKT+ QQVF DD+WCV GINNV + DK+FK+ Sbjct: 4 IEARALKSSFLSDMAMKTS-QQVFLDDIWCVAGINNVPSDDFSVDDLLDFSDKDFKD 59