BLASTX nr result
ID: Bupleurum21_contig00004814
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00004814 (393 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530188.1| conserved hypothetical protein [Ricinus comm... 73 3e-11 >ref|XP_002530188.1| conserved hypothetical protein [Ricinus communis] gi|223530307|gb|EEF32202.1| conserved hypothetical protein [Ricinus communis] Length = 460 Score = 72.8 bits (177), Expect = 3e-11 Identities = 48/132 (36%), Positives = 71/132 (53%), Gaps = 2/132 (1%) Frame = +3 Query: 3 KSCDVFEVK-LGTLETLNLVSSDLFSILSIFPITTTVWNLTLDSPRCA-PRDETFKFSLS 176 + + F+VK L L+ L L S+D+ S++ +FP ++V LT+DSP+ A DE + +L Sbjct: 278 RKANKFKVKQLHDLKILQLESTDILSLIRLFPSNSSVERLTVDSPKYAIQTDEMIRLNLE 337 Query: 177 KVLKLFPNVTSLTLGSGVWSQQMAYPSAPLGKGLTAKNRMNGLKQITLYFVHGDIDRALC 356 + +F NV+SLTL S WS L GL M LK++ + V DID L Sbjct: 338 MLFDVFMNVSSLTLLSAAWSDM---EKCFLTNGLRHDMEMKELKEVIVQLVIQDIDVTLS 394 Query: 357 FILYVVRICANL 392 FI ++ C NL Sbjct: 395 FIFTILDKCTNL 406