BLASTX nr result
ID: Bupleurum21_contig00004438
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00004438 (444 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004138254.1| PREDICTED: uncharacterized protein LOC101222... 59 3e-07 ref|NP_201159.2| uncharacterized protein [Arabidopsis thaliana] ... 58 7e-07 ref|XP_002866560.1| hypothetical protein ARALYDRAFT_919644 [Arab... 58 7e-07 emb|CBI15702.3| unnamed protein product [Vitis vinifera] 58 7e-07 ref|XP_002280344.1| PREDICTED: uncharacterized protein LOC100244... 58 7e-07 >ref|XP_004138254.1| PREDICTED: uncharacterized protein LOC101222548 [Cucumis sativus] gi|449523926|ref|XP_004168974.1| PREDICTED: uncharacterized LOC101222548 [Cucumis sativus] Length = 601 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -2 Query: 443 LSMTDGVQRVFGMEYRPIKGLEVLAPAGMK 354 LSMTDGVQR+FGMEYRPIK LEVLAPAG+K Sbjct: 208 LSMTDGVQRIFGMEYRPIKNLEVLAPAGLK 237 >ref|NP_201159.2| uncharacterized protein [Arabidopsis thaliana] gi|52354591|gb|AAU44616.1| hypothetical protein AT5G63540 [Arabidopsis thaliana] gi|61742771|gb|AAX55206.1| hypothetical protein At5g63540 [Arabidopsis thaliana] gi|332010382|gb|AED97765.1| uncharacterized protein [Arabidopsis thaliana] Length = 644 Score = 58.2 bits (139), Expect = 7e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -2 Query: 443 LSMTDGVQRVFGMEYRPIKGLEVLAPAGMK 354 LSMTDGVQRVFGMEYRPIK L+VLAPAG+K Sbjct: 206 LSMTDGVQRVFGMEYRPIKDLQVLAPAGLK 235 >ref|XP_002866560.1| hypothetical protein ARALYDRAFT_919644 [Arabidopsis lyrata subsp. lyrata] gi|297312395|gb|EFH42819.1| hypothetical protein ARALYDRAFT_919644 [Arabidopsis lyrata subsp. lyrata] Length = 640 Score = 58.2 bits (139), Expect = 7e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -2 Query: 443 LSMTDGVQRVFGMEYRPIKGLEVLAPAGMK 354 LSMTDGVQRVFGMEYRPIK L+VLAPAG+K Sbjct: 212 LSMTDGVQRVFGMEYRPIKDLQVLAPAGLK 241 >emb|CBI15702.3| unnamed protein product [Vitis vinifera] Length = 628 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -2 Query: 443 LSMTDGVQRVFGMEYRPIKGLEVLAPAGMK 354 LSMTDG+QRVFGMEYRPIK +EVLAPAG+K Sbjct: 206 LSMTDGIQRVFGMEYRPIKDIEVLAPAGLK 235 >ref|XP_002280344.1| PREDICTED: uncharacterized protein LOC100244067 [Vitis vinifera] Length = 626 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -2 Query: 443 LSMTDGVQRVFGMEYRPIKGLEVLAPAGMK 354 LSMTDG+QRVFGMEYRPIK +EVLAPAG+K Sbjct: 204 LSMTDGIQRVFGMEYRPIKDIEVLAPAGLK 233