BLASTX nr result
ID: Bupleurum21_contig00004409
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00004409 (835 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002318524.1| high mobility group family [Populus trichoca... 60 5e-07 gb|AAA50196.1| DNA-binding protein [Nicotiana tabacum] 60 6e-07 ref|XP_003518169.1| PREDICTED: uncharacterized protein LOC100789... 60 6e-07 ref|XP_003533338.1| PREDICTED: uncharacterized protein LOC100788... 59 2e-06 ref|XP_002534496.1| histone h1/h5, putative [Ricinus communis] g... 59 2e-06 >ref|XP_002318524.1| high mobility group family [Populus trichocarpa] gi|222859197|gb|EEE96744.1| high mobility group family [Populus trichocarpa] Length = 369 Score = 60.5 bits (145), Expect = 5e-07 Identities = 28/45 (62%), Positives = 34/45 (75%) Frame = -1 Query: 835 MKEKDGSSRQAISKYIENVYSNLSPDHGNLLTQQLRRMKNEGQLV 701 +KE+DGSSR AI+KYIE Y LSP H +LLT L+R+KN G LV Sbjct: 62 LKEQDGSSRIAIAKYIERAYPGLSPSHSDLLTHHLKRLKNSGALV 106 >gb|AAA50196.1| DNA-binding protein [Nicotiana tabacum] Length = 546 Score = 60.1 bits (144), Expect = 6e-07 Identities = 27/44 (61%), Positives = 35/44 (79%) Frame = -1 Query: 835 MKEKDGSSRQAISKYIENVYSNLSPDHGNLLTQQLRRMKNEGQL 704 +KE+DGSSR AI+KYI+ VY+NL P+H LLT L+R+KN G L Sbjct: 58 LKERDGSSRIAIAKYIDRVYTNLPPNHSALLTHHLKRLKNSGYL 101 >ref|XP_003518169.1| PREDICTED: uncharacterized protein LOC100789987 [Glycine max] Length = 484 Score = 60.1 bits (144), Expect = 6e-07 Identities = 27/44 (61%), Positives = 35/44 (79%) Frame = -1 Query: 835 MKEKDGSSRQAISKYIENVYSNLSPDHGNLLTQQLRRMKNEGQL 704 +KEKDGSS++AI+KYIE VY+ L P+H NLLTQ L +K+ G L Sbjct: 237 LKEKDGSSKRAIAKYIEQVYTQLPPNHSNLLTQHLTHLKSRGLL 280 >ref|XP_003533338.1| PREDICTED: uncharacterized protein LOC100788215 [Glycine max] Length = 477 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/44 (59%), Positives = 35/44 (79%) Frame = -1 Query: 835 MKEKDGSSRQAISKYIENVYSNLSPDHGNLLTQQLRRMKNEGQL 704 +KEKDGSS++AI+KYIE VY+ L P+H +LLTQ L +K+ G L Sbjct: 52 LKEKDGSSKRAIAKYIEQVYTQLPPNHSDLLTQHLNHLKSRGLL 95 >ref|XP_002534496.1| histone h1/h5, putative [Ricinus communis] gi|223525178|gb|EEF27887.1| histone h1/h5, putative [Ricinus communis] Length = 435 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/45 (60%), Positives = 34/45 (75%) Frame = -1 Query: 835 MKEKDGSSRQAISKYIENVYSNLSPDHGNLLTQQLRRMKNEGQLV 701 +KE+DGSS++AI+KYIE VY L P H LLT L+R+KN G LV Sbjct: 83 LKERDGSSKRAIAKYIERVYPGLPPTHSALLTHHLKRLKNTGLLV 127