BLASTX nr result
ID: Bupleurum21_contig00004200
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00004200 (309 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525265.1| transcription cofactor, putative [Ricinus co... 60 1e-07 ref|XP_003632492.1| PREDICTED: BTB/POZ and TAZ domain-containing... 59 4e-07 ref|XP_002304319.1| hypothetical protein POPTRDRAFT_413626 [Popu... 54 1e-05 >ref|XP_002525265.1| transcription cofactor, putative [Ricinus communis] gi|223535423|gb|EEF37093.1| transcription cofactor, putative [Ricinus communis] Length = 347 Score = 60.5 bits (145), Expect = 1e-07 Identities = 29/46 (63%), Positives = 35/46 (76%) Frame = +1 Query: 1 VPLCSNLKNRIMKQGKYRKDDIKWRILVRKIVRARSITGAPFFTLA 138 VPLC N K RI +Q K KD+IKWRILV+KI+R + I G+PFFT A Sbjct: 299 VPLCKNFKARIKRQSK--KDEIKWRILVKKIIRTKRIGGSPFFTSA 342 >ref|XP_003632492.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 4-like [Vitis vinifera] gi|296087324|emb|CBI33698.3| unnamed protein product [Vitis vinifera] Length = 371 Score = 58.9 bits (141), Expect = 4e-07 Identities = 29/43 (67%), Positives = 34/43 (79%) Frame = +1 Query: 1 VPLCSNLKNRIMKQGKYRKDDIKWRILVRKIVRARSITGAPFF 129 VPLC N K+RI KQ K KD++KWRILVRKI+RA+ I APFF Sbjct: 331 VPLCRNFKDRIKKQSK--KDEMKWRILVRKILRAKGIGKAPFF 371 >ref|XP_002304319.1| hypothetical protein POPTRDRAFT_413626 [Populus trichocarpa] gi|222841751|gb|EEE79298.1| hypothetical protein POPTRDRAFT_413626 [Populus trichocarpa] Length = 329 Score = 54.3 bits (129), Expect = 1e-05 Identities = 25/43 (58%), Positives = 32/43 (74%) Frame = +1 Query: 1 VPLCSNLKNRIMKQGKYRKDDIKWRILVRKIVRARSITGAPFF 129 VPLC N K R KQ K KD+I+WRILV+ I++ +SI G+PFF Sbjct: 289 VPLCRNFKERTKKQSK--KDEIRWRILVKNILKTKSIGGSPFF 329