BLASTX nr result
ID: Bupleurum21_contig00004191
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00004191 (710 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|P23326.1|RK35_SPIOL RecName: Full=50S ribosomal protein L35, ... 58 2e-06 ref|XP_003610263.1| 50S ribosomal protein L35 [Medicago truncatu... 56 8e-06 >sp|P23326.1|RK35_SPIOL RecName: Full=50S ribosomal protein L35, chloroplastic; AltName: Full=CL35; Flags: Precursor gi|189096153|pdb|3BBO|5 Chain 5, Homology Model For The Spinach Chloroplast 50s Subunit Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome gi|170139|gb|AAA34043.1| ribosomal protein L35 [Spinacia oleracea] Length = 159 Score = 57.8 bits (138), Expect = 2e-06 Identities = 30/48 (62%), Positives = 32/48 (66%) Frame = -2 Query: 328 IVRRRAGKQHXXXXXXXXXXXXXXXXLQVDRSDYNNVIGALPYLKVNR 185 IVRRRAGKQH +QVDRSDY+NVIGALPYLKVNR Sbjct: 110 IVRRRAGKQHLLAKKNTKRKNRLSKLIQVDRSDYDNVIGALPYLKVNR 157 >ref|XP_003610263.1| 50S ribosomal protein L35 [Medicago truncatula] gi|217071304|gb|ACJ84012.1| unknown [Medicago truncatula] gi|355511318|gb|AES92460.1| 50S ribosomal protein L35 [Medicago truncatula] gi|388495356|gb|AFK35744.1| unknown [Medicago truncatula] Length = 148 Score = 55.8 bits (133), Expect = 8e-06 Identities = 29/48 (60%), Positives = 32/48 (66%) Frame = -2 Query: 328 IVRRRAGKQHXXXXXXXXXXXXXXXXLQVDRSDYNNVIGALPYLKVNR 185 IVRRRAGKQH +QV+RSDY+NVIGALPYLKVNR Sbjct: 98 IVRRRAGKQHLLYKKNKKRKLRLSKMIQVNRSDYDNVIGALPYLKVNR 145