BLASTX nr result
ID: Bupleurum21_contig00003140
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00003140 (399 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_172192.1| uncharacterized protein [Arabidopsis thaliana] ... 66 3e-09 ref|XP_002892381.1| hypothetical protein ARALYDRAFT_470733 [Arab... 66 3e-09 ref|XP_003539335.1| PREDICTED: protein CHUP1, chloroplastic-like... 64 1e-08 ref|XP_003544301.1| PREDICTED: protein CHUP1, chloroplastic-like... 64 2e-08 emb|CBI15924.3| unnamed protein product [Vitis vinifera] 62 5e-08 >ref|NP_172192.1| uncharacterized protein [Arabidopsis thaliana] gi|8954035|gb|AAF82209.1|AC067971_17 Contains similarity to a hypothetical protein F28J12.220 gi|7486298 from Arabidopsis thaliana BAC F28J12 gb|AL021710. It contains a bZIP transcription factor domain PF|00170 [Arabidopsis thaliana] gi|332189957|gb|AEE28078.1| uncharacterized protein [Arabidopsis thaliana] Length = 392 Score = 66.2 bits (160), Expect = 3e-09 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = -3 Query: 223 RLEQSVSNIEKGREGTSKRYRDFHIPWEWMLDTRLIGHVRY 101 RLE+SV+N EK R+ T KRY+DF IPWEWMLDT LIG ++Y Sbjct: 285 RLEESVNNTEKMRDSTGKRYKDFQIPWEWMLDTGLIGQLKY 325 >ref|XP_002892381.1| hypothetical protein ARALYDRAFT_470733 [Arabidopsis lyrata subsp. lyrata] gi|297338223|gb|EFH68640.1| hypothetical protein ARALYDRAFT_470733 [Arabidopsis lyrata subsp. lyrata] Length = 391 Score = 65.9 bits (159), Expect = 3e-09 Identities = 27/42 (64%), Positives = 35/42 (83%) Frame = -3 Query: 223 RLEQSVSNIEKGREGTSKRYRDFHIPWEWMLDTRLIGHVRYK 98 RLE++V+N EK R+ T KRY+DF IPWEWMLDT LIG ++Y+ Sbjct: 285 RLEENVNNTEKMRDSTGKRYKDFQIPWEWMLDTGLIGQLKYR 326 >ref|XP_003539335.1| PREDICTED: protein CHUP1, chloroplastic-like [Glycine max] Length = 494 Score = 64.3 bits (155), Expect = 1e-08 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = -3 Query: 223 RLEQSVSNIEKGREGTSKRYRDFHIPWEWMLDTRLIGHVR 104 RLE+SV++ EK RE SKRYR FHIPWEWMLDT LIG ++ Sbjct: 367 RLERSVNSAEKTRESASKRYRSFHIPWEWMLDTGLIGQMK 406 >ref|XP_003544301.1| PREDICTED: protein CHUP1, chloroplastic-like [Glycine max] Length = 449 Score = 63.5 bits (153), Expect = 2e-08 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = -3 Query: 223 RLEQSVSNIEKGREGTSKRYRDFHIPWEWMLDTRLIGHVR 104 RLE+SVS E+ RE TSKRYR+FHIPWEWMLDT +IG ++ Sbjct: 324 RLERSVSAKERMRESTSKRYRNFHIPWEWMLDTGIIGQMK 363 >emb|CBI15924.3| unnamed protein product [Vitis vinifera] Length = 324 Score = 62.0 bits (149), Expect = 5e-08 Identities = 25/40 (62%), Positives = 35/40 (87%) Frame = -3 Query: 223 RLEQSVSNIEKGREGTSKRYRDFHIPWEWMLDTRLIGHVR 104 R+E+SV+N+EK R+G SKRY++F IPWEWML+T LIG ++ Sbjct: 207 RVERSVANMEKMRDGASKRYKEFQIPWEWMLNTGLIGQIK 246