BLASTX nr result
ID: Bupleurum21_contig00002845
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00002845 (310 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528647.1| cytochrome P450, putative [Ricinus communis]... 75 7e-12 ref|XP_002528650.1| cytochrome P450, putative [Ricinus communis]... 74 1e-11 ref|XP_002528653.1| cytochrome P450, putative [Ricinus communis]... 72 5e-11 ref|XP_002528649.1| cytochrome P450, putative [Ricinus communis]... 71 1e-10 ref|XP_002528654.1| cytochrome P450, putative [Ricinus communis]... 69 3e-10 >ref|XP_002528647.1| cytochrome P450, putative [Ricinus communis] gi|223531936|gb|EEF33750.1| cytochrome P450, putative [Ricinus communis] Length = 512 Score = 74.7 bits (182), Expect = 7e-12 Identities = 31/47 (65%), Positives = 37/47 (78%) Frame = -1 Query: 142 GNTSTSRKVPPGPPAWPLVGNIFDLGTRPHQKFYELRKKYGPVLWIK 2 GN T + PPGPP WP++GNIFDLGT PHQ Y+LR KYGPVLW++ Sbjct: 26 GNHRTKSR-PPGPPGWPVIGNIFDLGTMPHQTLYKLRFKYGPVLWLR 71 >ref|XP_002528650.1| cytochrome P450, putative [Ricinus communis] gi|223531939|gb|EEF33753.1| cytochrome P450, putative [Ricinus communis] Length = 504 Score = 73.9 bits (180), Expect = 1e-11 Identities = 28/42 (66%), Positives = 36/42 (85%) Frame = -1 Query: 127 SRKVPPGPPAWPLVGNIFDLGTRPHQKFYELRKKYGPVLWIK 2 +++ PPGPPAWP++GNIFDLG PHQ Y+LR KYGPVLW++ Sbjct: 37 AKQRPPGPPAWPIIGNIFDLGGNPHQNLYKLRFKYGPVLWLR 78 >ref|XP_002528653.1| cytochrome P450, putative [Ricinus communis] gi|223531942|gb|EEF33756.1| cytochrome P450, putative [Ricinus communis] Length = 515 Score = 72.0 bits (175), Expect = 5e-11 Identities = 27/42 (64%), Positives = 35/42 (83%) Frame = -1 Query: 127 SRKVPPGPPAWPLVGNIFDLGTRPHQKFYELRKKYGPVLWIK 2 +++ PPGPPAWP++GNIFDLG PHQ Y+L KYGPVLW++ Sbjct: 34 AKQRPPGPPAWPIIGNIFDLGANPHQNLYKLGFKYGPVLWLR 75 >ref|XP_002528649.1| cytochrome P450, putative [Ricinus communis] gi|223531938|gb|EEF33752.1| cytochrome P450, putative [Ricinus communis] Length = 524 Score = 70.9 bits (172), Expect = 1e-10 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -1 Query: 115 PPGPPAWPLVGNIFDLGTRPHQKFYELRKKYGPVLWIK 2 PPGPPAWP+ GNIFDLGT PH+ Y+ R KYGPVLW++ Sbjct: 48 PPGPPAWPIFGNIFDLGTIPHRNLYKFRYKYGPVLWLR 85 >ref|XP_002528654.1| cytochrome P450, putative [Ricinus communis] gi|223531943|gb|EEF33757.1| cytochrome P450, putative [Ricinus communis] Length = 514 Score = 69.3 bits (168), Expect = 3e-10 Identities = 25/42 (59%), Positives = 33/42 (78%) Frame = -1 Query: 127 SRKVPPGPPAWPLVGNIFDLGTRPHQKFYELRKKYGPVLWIK 2 +++ PP PP WP++GNIFDLG PHQ Y+L KYGPVLW++ Sbjct: 34 AKQTPPAPPGWPIIGNIFDLGANPHQNLYKLGIKYGPVLWLR 75