BLASTX nr result
ID: Bupleurum21_contig00002742
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00002742 (458 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI19888.3| unnamed protein product [Vitis vinifera] 56 3e-06 ref|XP_002273623.1| PREDICTED: E3 ubiquitin-protein ligase CIP8 ... 56 3e-06 >emb|CBI19888.3| unnamed protein product [Vitis vinifera] Length = 285 Score = 55.8 bits (133), Expect = 3e-06 Identities = 22/44 (50%), Positives = 31/44 (70%) Frame = +3 Query: 33 IEYWCYQCDK*VNVETLADYAQIVCY*CKSGFV*SISPAPPSSD 164 + YWCYQCDK V++ETL D ++C CK+GFV +I AP + + Sbjct: 25 LHYWCYQCDKHVSIETLPDLPDVICNECKTGFVETIGVAPTAPE 68 >ref|XP_002273623.1| PREDICTED: E3 ubiquitin-protein ligase CIP8 isoform 1 [Vitis vinifera] gi|359492263|ref|XP_003634390.1| PREDICTED: E3 ubiquitin-protein ligase CIP8 isoform 2 [Vitis vinifera] gi|147826680|emb|CAN66109.1| hypothetical protein VITISV_007725 [Vitis vinifera] Length = 334 Score = 55.8 bits (133), Expect = 3e-06 Identities = 22/44 (50%), Positives = 31/44 (70%) Frame = +3 Query: 33 IEYWCYQCDK*VNVETLADYAQIVCY*CKSGFV*SISPAPPSSD 164 + YWCYQCDK V++ETL D ++C CK+GFV +I AP + + Sbjct: 11 LHYWCYQCDKHVSIETLPDLPDVICNECKTGFVETIGVAPTAPE 54