BLASTX nr result
ID: Bupleurum21_contig00002688
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00002688 (376 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533158.1| Root phototropism protein, putative [Ricinus... 62 4e-08 ref|XP_003517336.1| PREDICTED: BTB/POZ domain-containing protein... 60 1e-07 ref|XP_003538794.1| PREDICTED: BTB/POZ domain-containing protein... 59 4e-07 ref|XP_002284242.2| PREDICTED: BTB/POZ domain-containing protein... 59 5e-07 emb|CBI33715.3| unnamed protein product [Vitis vinifera] 59 5e-07 >ref|XP_002533158.1| Root phototropism protein, putative [Ricinus communis] gi|223527030|gb|EEF29217.1| Root phototropism protein, putative [Ricinus communis] Length = 621 Score = 62.4 bits (150), Expect = 4e-08 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = -1 Query: 127 YTYMQFPLVSKCGLIRKRYSESGDTNLSDIEIPDVPGGAEAF 2 ++ +FPLVSKCG IRK SES D +L +IEIPD+PGGAEAF Sbjct: 58 FSLHKFPLVSKCGYIRKLVSESSDADLGEIEIPDIPGGAEAF 99 >ref|XP_003517336.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Glycine max] Length = 618 Score = 60.5 bits (145), Expect = 1e-07 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = -1 Query: 127 YTYMQFPLVSKCGLIRKRYSESGDTNLSDIEIPDVPGGAEAF 2 ++ +FPLVSKCG IRK SES D ++S IE+PDVPGGAEAF Sbjct: 53 FSLHKFPLVSKCGYIRKLVSESNDADVSFIELPDVPGGAEAF 94 >ref|XP_003538794.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Glycine max] Length = 617 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/42 (64%), Positives = 34/42 (80%) Frame = -1 Query: 127 YTYMQFPLVSKCGLIRKRYSESGDTNLSDIEIPDVPGGAEAF 2 ++ +FPLVSKCG IRK SES D ++S IE+P+VPGGAEAF Sbjct: 52 FSLHKFPLVSKCGYIRKLVSESNDADVSFIELPEVPGGAEAF 93 >ref|XP_002284242.2| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 1 [Vitis vinifera] Length = 636 Score = 58.5 bits (140), Expect = 5e-07 Identities = 28/42 (66%), Positives = 33/42 (78%) Frame = -1 Query: 127 YTYMQFPLVSKCGLIRKRYSESGDTNLSDIEIPDVPGGAEAF 2 ++ +FPLVSKCG IRK SES D +LS IE+ DVPGGAEAF Sbjct: 53 FSLHKFPLVSKCGYIRKLVSESSDADLSVIEVHDVPGGAEAF 94 >emb|CBI33715.3| unnamed protein product [Vitis vinifera] Length = 529 Score = 58.5 bits (140), Expect = 5e-07 Identities = 28/42 (66%), Positives = 33/42 (78%) Frame = -1 Query: 127 YTYMQFPLVSKCGLIRKRYSESGDTNLSDIEIPDVPGGAEAF 2 ++ +FPLVSKCG IRK SES D +LS IE+ DVPGGAEAF Sbjct: 38 FSLHKFPLVSKCGYIRKLVSESSDADLSVIEVHDVPGGAEAF 79