BLASTX nr result
ID: Bupleurum21_contig00002545
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00002545 (722 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAJ95186.1| predicted protein [Hordeum vulgare subsp. vulgare] 64 2e-08 sp|P00068.1|CYC_WHEAT RecName: Full=Cytochrome c 62 9e-08 ref|XP_002439820.1| hypothetical protein SORBIDRAFT_09g020710 [S... 62 2e-07 gb|ACR35464.1| unknown [Zea mays] gi|413949251|gb|AFW81900.1| hy... 62 2e-07 gb|ACG36310.1| cytochrome c [Zea mays] gi|223945271|gb|ACN26719.... 62 2e-07 >dbj|BAJ95186.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 113 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -2 Query: 664 MASFAEAPPGNKDAGAKIFKTKCAQCHTVEQG 569 MASF+EAPPGN DAGAKIFKTKCAQCHTV+ G Sbjct: 1 MASFSEAPPGNPDAGAKIFKTKCAQCHTVDAG 32 >sp|P00068.1|CYC_WHEAT RecName: Full=Cytochrome c Length = 112 Score = 62.4 bits (150), Expect = 9e-08 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -2 Query: 661 ASFAEAPPGNKDAGAKIFKTKCAQCHTVEQG 569 ASF+EAPPGN DAGAKIFKTKCAQCHTV+ G Sbjct: 1 ASFSEAPPGNPDAGAKIFKTKCAQCHTVDAG 31 >ref|XP_002439820.1| hypothetical protein SORBIDRAFT_09g020710 [Sorghum bicolor] gi|241945105|gb|EES18250.1| hypothetical protein SORBIDRAFT_09g020710 [Sorghum bicolor] Length = 112 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -2 Query: 664 MASFAEAPPGNKDAGAKIFKTKCAQCHTVEQG 569 MASF+EAPPGN AG KIFKTKCAQCHTVE+G Sbjct: 1 MASFSEAPPGNPKAGEKIFKTKCAQCHTVEKG 32 >gb|ACR35464.1| unknown [Zea mays] gi|413949251|gb|AFW81900.1| hypothetical protein ZEAMMB73_689570 [Zea mays] Length = 84 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -2 Query: 664 MASFAEAPPGNKDAGAKIFKTKCAQCHTVEQG 569 MASF+EAPPGN AG KIFKTKCAQCHTVE+G Sbjct: 1 MASFSEAPPGNPKAGEKIFKTKCAQCHTVEKG 32 >gb|ACG36310.1| cytochrome c [Zea mays] gi|223945271|gb|ACN26719.1| unknown [Zea mays] gi|413949252|gb|AFW81901.1| cytochrome c [Zea mays] Length = 112 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -2 Query: 664 MASFAEAPPGNKDAGAKIFKTKCAQCHTVEQG 569 MASF+EAPPGN AG KIFKTKCAQCHTVE+G Sbjct: 1 MASFSEAPPGNPKAGEKIFKTKCAQCHTVEKG 32