BLASTX nr result
ID: Bupleurum21_contig00001678
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00001678 (278 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_182283.1| 60S ribosomal protein L7a-1 [Arabidopsis thalia... 69 3e-10 dbj|BAD95148.1| 60S ribosomal protein L7A [Arabidopsis thaliana] 69 3e-10 ref|NP_191846.1| 60S ribosomal protein L7a-2 [Arabidopsis thalia... 69 3e-10 ref|XP_003540735.1| PREDICTED: 60S ribosomal protein L7a-like [G... 69 4e-10 ref|XP_003519707.1| PREDICTED: pentatricopeptide repeat-containi... 69 4e-10 >ref|NP_182283.1| 60S ribosomal protein L7a-1 [Arabidopsis thaliana] gi|6174956|sp|P49692.2|RL7A1_ARATH RecName: Full=60S ribosomal protein L7a-1 gi|14326531|gb|AAK60310.1|AF385719_1 At2g47610/T30B22.8 [Arabidopsis thaliana] gi|2529665|gb|AAC62850.1| 60S ribosomal protein L7A [Arabidopsis thaliana] gi|15450613|gb|AAK96578.1| At2g47610/T30B22.8 [Arabidopsis thaliana] gi|21594006|gb|AAM65924.1| 60S ribosomal protein L7A [Arabidopsis thaliana] gi|23308199|gb|AAN18069.1| At2g47610/T30B22.8 [Arabidopsis thaliana] gi|330255770|gb|AEC10864.1| 60S ribosomal protein L7a-1 [Arabidopsis thaliana] Length = 257 Score = 69.3 bits (168), Expect = 3e-10 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -3 Query: 276 YRKKWGGGIMGSKSQAKTRAKERVLAKEAAQRMN 175 YRKKWGGGIMGSKSQAKT+AKERV+AKEAAQRMN Sbjct: 224 YRKKWGGGIMGSKSQAKTKAKERVIAKEAAQRMN 257 >dbj|BAD95148.1| 60S ribosomal protein L7A [Arabidopsis thaliana] Length = 90 Score = 69.3 bits (168), Expect = 3e-10 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -3 Query: 276 YRKKWGGGIMGSKSQAKTRAKERVLAKEAAQRMN 175 YRKKWGGGIMGSKSQAKT+AKERV+AKEAAQRMN Sbjct: 57 YRKKWGGGIMGSKSQAKTKAKERVIAKEAAQRMN 90 >ref|NP_191846.1| 60S ribosomal protein L7a-2 [Arabidopsis thaliana] gi|75311725|sp|Q9LZH9.1|RL7A2_ARATH RecName: Full=60S ribosomal protein L7a-2 gi|7362767|emb|CAB83137.1| 60S RIBOSOMAL PROTEIN L7A protein [Arabidopsis thaliana] gi|15529280|gb|AAK97734.1| AT3g62870/F26K9_300 [Arabidopsis thaliana] gi|16974413|gb|AAL31132.1| AT3g62870/F26K9_300 [Arabidopsis thaliana] gi|17065364|gb|AAL32836.1| 60S RIBOSOMAL PROTEIN L7A protein [Arabidopsis thaliana] gi|21387165|gb|AAM47986.1| 60S ribosomal protein L7A protein [Arabidopsis thaliana] gi|21592470|gb|AAM64421.1| 60S RIBOSOMAL PROTEIN L7A protein [Arabidopsis thaliana] gi|332646883|gb|AEE80404.1| 60S ribosomal protein L7a-2 [Arabidopsis thaliana] Length = 256 Score = 69.3 bits (168), Expect = 3e-10 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -3 Query: 276 YRKKWGGGIMGSKSQAKTRAKERVLAKEAAQRMN 175 YRKKWGGGIMGSKSQAKT+AKERV+AKEAAQRMN Sbjct: 223 YRKKWGGGIMGSKSQAKTKAKERVIAKEAAQRMN 256 >ref|XP_003540735.1| PREDICTED: 60S ribosomal protein L7a-like [Glycine max] Length = 259 Score = 68.9 bits (167), Expect = 4e-10 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -3 Query: 276 YRKKWGGGIMGSKSQAKTRAKERVLAKEAAQRMN 175 YRKKWGGGIMGSKSQAKTRAKE++LAKEAAQRMN Sbjct: 226 YRKKWGGGIMGSKSQAKTRAKEKLLAKEAAQRMN 259 >ref|XP_003519707.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like [Glycine max] Length = 554 Score = 68.9 bits (167), Expect = 4e-10 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -3 Query: 276 YRKKWGGGIMGSKSQAKTRAKERVLAKEAAQRMN 175 YRKKWGGGIMGSKSQAKTRAKE++LAKEAAQRMN Sbjct: 521 YRKKWGGGIMGSKSQAKTRAKEKLLAKEAAQRMN 554