BLASTX nr result
ID: Bupleurum21_contig00001626
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00001626 (369 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002509569.1| ankyrin repeat-containing protein, putative ... 57 2e-06 >ref|XP_002509569.1| ankyrin repeat-containing protein, putative [Ricinus communis] gi|223549468|gb|EEF50956.1| ankyrin repeat-containing protein, putative [Ricinus communis] Length = 655 Score = 56.6 bits (135), Expect = 2e-06 Identities = 46/131 (35%), Positives = 64/131 (48%), Gaps = 9/131 (6%) Frame = -2 Query: 368 PGTSFRISDSELFLHMGIK---ERGTRIRSNGMASARLSAEPTKTRKIDFVMESYGPKNN 198 PGTSFRISD+E+FL+ GI+ + S GM+SA SAE +D + E+ N Sbjct: 402 PGTSFRISDAEIFLYTGIEIASDASADRASEGMSSA--SAE-----HLDSINENRNSTTN 454 Query: 197 TKQSSVNDTAQRLXXXXXXXXXXXXXXXXXXKIIGEIS------LGSSDGIPVSLRQKYS 36 K S+N+ AQ+L K + S SS+ P LRQK+ Sbjct: 455 RKSVSINNAAQQLKRVLHWPRLKGKKPERFSKSLDLSSAESCKKYSSSEEAPTPLRQKFM 514 Query: 35 QCTSLANNKRT 3 + ++L NNKRT Sbjct: 515 KPSALPNNKRT 525