BLASTX nr result
ID: Bupleurum21_contig00001594
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00001594 (280 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAD26953.1| putative non-LTR retrolelement reverse transcript... 58 7e-07 >gb|AAD26953.1| putative non-LTR retrolelement reverse transcriptase [Arabidopsis thaliana] Length = 323 Score = 58.2 bits (139), Expect = 7e-07 Identities = 35/94 (37%), Positives = 44/94 (46%), Gaps = 4/94 (4%) Frame = +3 Query: 6 TRSRLVSYGLMDDVVCGLCCQFDETEQHLFFNCSYSAHI----IACCSFDIPKDLHSICA 173 TR RL +GL VC LC DET HLFF C +S I + P I Sbjct: 181 TRDRLTQWGLNIPTVCVLCNVVDETHDHLFFQCQFSNEIWSFFMIRAGMTPPHLFGPILL 240 Query: 174 FADSLPRLSFKLLYVKVFTVAAVYYIWQKRNCRI 275 + S L +K+ A+VY IW++RNCRI Sbjct: 241 WLKSASSSKNLSLIIKLLFQASVYLIWRERNCRI 274