BLASTX nr result
ID: Bupleurum21_contig00001386
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00001386 (587 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002280795.2| PREDICTED: uncharacterized protein LOC100263... 80 2e-13 ref|XP_002512380.1| pentatricopeptide repeat-containing protein,... 80 3e-13 emb|CAN60541.1| hypothetical protein VITISV_018290 [Vitis vinifera] 79 7e-13 ref|XP_002319537.1| predicted protein [Populus trichocarpa] gi|2... 76 5e-12 ref|XP_004156421.1| PREDICTED: putative pentatricopeptide repeat... 74 2e-11 >ref|XP_002280795.2| PREDICTED: uncharacterized protein LOC100263014 [Vitis vinifera] gi|296088328|emb|CBI36773.3| unnamed protein product [Vitis vinifera] Length = 265 Score = 80.5 bits (197), Expect = 2e-13 Identities = 37/52 (71%), Positives = 39/52 (75%), Gaps = 7/52 (13%) Frame = +1 Query: 451 LLDICS-------ECLDPFDKPECVASDLFVNEVLCAGKGCPYSCVTRAPHA 585 LL CS ECLDPFD+PEC A DLFVNEVLC GKGCPYSCV +APHA Sbjct: 116 LLSCCSRSEIIERECLDPFDEPECEAFDLFVNEVLCVGKGCPYSCVNKAPHA 167 >ref|XP_002512380.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223548341|gb|EEF49832.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 736 Score = 80.1 bits (196), Expect = 3e-13 Identities = 34/40 (85%), Positives = 35/40 (87%) Frame = +1 Query: 466 SECLDPFDKPECVASDLFVNEVLCAGKGCPYSCVTRAPHA 585 SECLDPFD PEC A D+FVNEVLCAGKGCPYSCV APHA Sbjct: 599 SECLDPFDNPECEAFDIFVNEVLCAGKGCPYSCVQTAPHA 638 >emb|CAN60541.1| hypothetical protein VITISV_018290 [Vitis vinifera] Length = 322 Score = 78.6 bits (192), Expect = 7e-13 Identities = 36/52 (69%), Positives = 38/52 (73%), Gaps = 7/52 (13%) Frame = +1 Query: 451 LLDICS-------ECLDPFDKPECVASDLFVNEVLCAGKGCPYSCVTRAPHA 585 LL CS ECLDPFD+PEC A DLFVNEVLC G GCPYSCV +APHA Sbjct: 115 LLSCCSRSEIIERECLDPFDEPECEAFDLFVNEVLCVGNGCPYSCVNKAPHA 166 >ref|XP_002319537.1| predicted protein [Populus trichocarpa] gi|222857913|gb|EEE95460.1| predicted protein [Populus trichocarpa] Length = 266 Score = 75.9 bits (185), Expect = 5e-12 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = +1 Query: 469 ECLDPFDKPECVASDLFVNEVLCAGKGCPYSCVTRAPHA 585 ECLDPF++PEC A D+FVNEVLC GKGCPYSCV RAP+A Sbjct: 130 ECLDPFEEPECEAFDIFVNEVLCVGKGCPYSCVQRAPYA 168 >ref|XP_004156421.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g68930-like [Cucumis sativus] Length = 833 Score = 73.9 bits (180), Expect = 2e-11 Identities = 30/38 (78%), Positives = 32/38 (84%) Frame = +1 Query: 469 ECLDPFDKPECVASDLFVNEVLCAGKGCPYSCVTRAPH 582 ECLDPF+ PEC A D+FVNE LC GKGCPYSCV RAPH Sbjct: 697 ECLDPFENPECEAFDVFVNEFLCVGKGCPYSCVDRAPH 734