BLASTX nr result
ID: Bupleurum21_contig00001073
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00001073 (429 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004146045.1| PREDICTED: probable aminotransferase TAT2-li... 72 5e-11 gb|ADC45389.1| aromatic amino acid transaminase [Cucumis melo] 71 8e-11 ref|XP_002523289.1| tyrosine aminotransferase, putative [Ricinus... 69 3e-10 gb|ADO17550.1| tyrosine aminotransferase [Perilla frutescens] 69 4e-10 emb|CBI20258.3| unnamed protein product [Vitis vinifera] 69 4e-10 >ref|XP_004146045.1| PREDICTED: probable aminotransferase TAT2-like [Cucumis sativus] gi|449520475|ref|XP_004167259.1| PREDICTED: probable aminotransferase TAT2-like [Cucumis sativus] Length = 412 Score = 72.0 bits (175), Expect = 5e-11 Identities = 33/44 (75%), Positives = 39/44 (88%) Frame = +2 Query: 296 IDTPSTITIKGILGLLMANADDKDERRLISLGMGDPTAFSCFHT 427 +DT STITIKGIL LL+ NAD+ + RRLISLGMGDP+A+SCFHT Sbjct: 10 VDTASTITIKGILSLLVQNADENNGRRLISLGMGDPSAYSCFHT 53 >gb|ADC45389.1| aromatic amino acid transaminase [Cucumis melo] Length = 412 Score = 71.2 bits (173), Expect = 8e-11 Identities = 36/54 (66%), Positives = 43/54 (79%) Frame = +2 Query: 266 MENGGDNKGHIDTPSTITIKGILGLLMANADDKDERRLISLGMGDPTAFSCFHT 427 ME G N +DT STI+IKGIL LL+ NAD+ + RRLISLGMGDP+A+SCFHT Sbjct: 1 MEIGAVNS-EMDTASTISIKGILSLLVQNADENNGRRLISLGMGDPSAYSCFHT 53 >ref|XP_002523289.1| tyrosine aminotransferase, putative [Ricinus communis] gi|223537502|gb|EEF39128.1| tyrosine aminotransferase, putative [Ricinus communis] Length = 415 Score = 69.3 bits (168), Expect = 3e-10 Identities = 34/53 (64%), Positives = 41/53 (77%) Frame = +2 Query: 269 ENGGDNKGHIDTPSTITIKGILGLLMANADDKDERRLISLGMGDPTAFSCFHT 427 ENG N+ ++TP ITIKGIL LLM N D+K R +ISLG+GDPTA+SCFHT Sbjct: 5 ENGTVNE--VETPKNITIKGILSLLMENIDEKAGRSVISLGIGDPTAYSCFHT 55 >gb|ADO17550.1| tyrosine aminotransferase [Perilla frutescens] Length = 411 Score = 68.9 bits (167), Expect = 4e-10 Identities = 34/49 (69%), Positives = 41/49 (83%), Gaps = 2/49 (4%) Frame = +2 Query: 284 NKGH-IDTPSTITIKGILGLLMANADDKDE-RRLISLGMGDPTAFSCFH 424 N H +D P+TITIKGILGLLMAN D K+ +R+ISLG+GDPTA+SCFH Sbjct: 5 NSAHEMDAPTTITIKGILGLLMANTDAKENGKRVISLGIGDPTAYSCFH 53 >emb|CBI20258.3| unnamed protein product [Vitis vinifera] Length = 450 Score = 68.9 bits (167), Expect = 4e-10 Identities = 34/61 (55%), Positives = 44/61 (72%), Gaps = 6/61 (9%) Frame = +2 Query: 263 EMENGGDNKGHID------TPSTITIKGILGLLMANADDKDERRLISLGMGDPTAFSCFH 424 EMENG + G D T +TITIKG++ LLMAN D+ + +RLISLGMGDP+ ++CFH Sbjct: 28 EMENGTNKWGFEDAENGPDTTTTITIKGLISLLMANIDEGNNKRLISLGMGDPSVYTCFH 87 Query: 425 T 427 T Sbjct: 88 T 88