BLASTX nr result
ID: Bupleurum21_contig00000378
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00000378 (420 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_175630.1| putative peptide transporter [Arabidopsis thali... 86 2e-15 ref|XP_002516544.1| nitrate transporter, putative [Ricinus commu... 86 2e-15 gb|AAM61194.1| unknown [Arabidopsis thaliana] 86 2e-15 ref|XP_002891678.1| proton-dependent oligopeptide transport fami... 86 3e-15 ref|XP_002279092.1| PREDICTED: probable peptide transporter At1g... 84 9e-15 >ref|NP_175630.1| putative peptide transporter [Arabidopsis thaliana] gi|75186219|sp|Q9M817.1|PTR2X_ARATH RecName: Full=Probable peptide transporter At1g52190 gi|6850341|gb|AAF29404.1|AC022354_3 peptide transporter, putative [Arabidopsis thaliana] gi|332194645|gb|AEE32766.1| putative peptide transporter [Arabidopsis thaliana] Length = 607 Score = 86.3 bits (212), Expect = 2e-15 Identities = 42/65 (64%), Positives = 49/65 (75%), Gaps = 1/65 (1%) Frame = -3 Query: 193 GMILLWLTAMFPEAKPGPCDPRTP-QLCKSTSTFQCFLLFSSFGLISIGA*GIRPCSLAF 17 GM+LLWLTAM P+ KP PCDP C S++ Q LL+S+F LISIG+ GIRPCSLAF Sbjct: 106 GMVLLWLTAMLPQVKPSPCDPTAAGSHCGSSTASQLALLYSAFALISIGSGGIRPCSLAF 165 Query: 16 GADQL 2 GADQL Sbjct: 166 GADQL 170 >ref|XP_002516544.1| nitrate transporter, putative [Ricinus communis] gi|223544364|gb|EEF45885.1| nitrate transporter, putative [Ricinus communis] Length = 578 Score = 86.3 bits (212), Expect = 2e-15 Identities = 42/64 (65%), Positives = 50/64 (78%) Frame = -3 Query: 193 GMILLWLTAMFPEAKPGPCDPRTPQLCKSTSTFQCFLLFSSFGLISIGA*GIRPCSLAFG 14 G+ILLWLTA+ P+A+P PCD T C+S +T Q LL+SSFGL+SIGA GIR SLAFG Sbjct: 106 GIILLWLTAVIPQARPLPCDQFTSDSCQSPTTLQLLLLYSSFGLLSIGAGGIRSSSLAFG 165 Query: 13 ADQL 2 ADQL Sbjct: 166 ADQL 169 >gb|AAM61194.1| unknown [Arabidopsis thaliana] Length = 292 Score = 86.3 bits (212), Expect = 2e-15 Identities = 42/65 (64%), Positives = 49/65 (75%), Gaps = 1/65 (1%) Frame = -3 Query: 193 GMILLWLTAMFPEAKPGPCDPRTP-QLCKSTSTFQCFLLFSSFGLISIGA*GIRPCSLAF 17 GM+LLWLTAM P+ KP PCDP C S++ Q LL+S+F LISIG+ GIRPCSLAF Sbjct: 106 GMVLLWLTAMLPQVKPSPCDPTAAGSHCGSSTASQLALLYSAFALISIGSGGIRPCSLAF 165 Query: 16 GADQL 2 GADQL Sbjct: 166 GADQL 170 >ref|XP_002891678.1| proton-dependent oligopeptide transport family protein [Arabidopsis lyrata subsp. lyrata] gi|297337520|gb|EFH67937.1| proton-dependent oligopeptide transport family protein [Arabidopsis lyrata subsp. lyrata] Length = 607 Score = 85.9 bits (211), Expect = 3e-15 Identities = 42/65 (64%), Positives = 48/65 (73%), Gaps = 1/65 (1%) Frame = -3 Query: 193 GMILLWLTAMFPEAKPGPCDPRTP-QLCKSTSTFQCFLLFSSFGLISIGA*GIRPCSLAF 17 GM+LLWLTAM P+ KP PCDP C S + Q LL+S+F LISIG+ GIRPCSLAF Sbjct: 106 GMVLLWLTAMLPQVKPSPCDPTAAGSHCGSATASQLALLYSAFALISIGSGGIRPCSLAF 165 Query: 16 GADQL 2 GADQL Sbjct: 166 GADQL 170 >ref|XP_002279092.1| PREDICTED: probable peptide transporter At1g52190-like [Vitis vinifera] Length = 584 Score = 84.3 bits (207), Expect = 9e-15 Identities = 43/64 (67%), Positives = 49/64 (76%) Frame = -3 Query: 193 GMILLWLTAMFPEAKPGPCDPRTPQLCKSTSTFQCFLLFSSFGLISIGA*GIRPCSLAFG 14 GMILLWLTAM P+ KP CD T Q CK+ + Q LL+SSF L+SIGA G+RPCSLAFG Sbjct: 101 GMILLWLTAMIPKTKPPHCDLLT-QSCKAPTAAQFILLYSSFALMSIGAGGVRPCSLAFG 159 Query: 13 ADQL 2 ADQL Sbjct: 160 ADQL 163