BLASTX nr result
ID: Bupleurum21_contig00000321
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00000321 (251 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_200799.1| histone H2B [Arabidopsis thaliana] gi|27735192|... 99 3e-19 gb|AAM63259.1| histone H2B-like protein [Arabidopsis thaliana] 99 3e-19 ref|XP_002864658.1| hypothetical protein ARALYDRAFT_496128 [Arab... 99 4e-19 ref|XP_002862747.1| hypothetical protein ARALYDRAFT_333229 [Arab... 99 4e-19 ref|XP_004143093.1| PREDICTED: probable histone H2B.1-like [Cucu... 98 6e-19 >ref|NP_200799.1| histone H2B [Arabidopsis thaliana] gi|27735192|sp|P40283.5|H2B11_ARATH RecName: Full=Histone H2B.11; AltName: Full=HTB4 gi|9757912|dbj|BAB08359.1| unnamed protein product [Arabidopsis thaliana] gi|16323079|gb|AAL15274.1| AT5g59910/mmn10_130 [Arabidopsis thaliana] gi|56236124|gb|AAV84518.1| At5g59910 [Arabidopsis thaliana] gi|98960893|gb|ABF58930.1| At5g59910 [Arabidopsis thaliana] gi|332009867|gb|AED97250.1| histone H2B [Arabidopsis thaliana] Length = 150 Score = 99.4 bits (246), Expect = 3e-19 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -1 Query: 152 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLAR 3 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLAR Sbjct: 59 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLAR 108 >gb|AAM63259.1| histone H2B-like protein [Arabidopsis thaliana] Length = 150 Score = 99.4 bits (246), Expect = 3e-19 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -1 Query: 152 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLAR 3 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLAR Sbjct: 59 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLAR 108 >ref|XP_002864658.1| hypothetical protein ARALYDRAFT_496128 [Arabidopsis lyrata subsp. lyrata] gi|297310493|gb|EFH40917.1| hypothetical protein ARALYDRAFT_496128 [Arabidopsis lyrata subsp. lyrata] Length = 145 Score = 99.0 bits (245), Expect = 4e-19 Identities = 49/50 (98%), Positives = 50/50 (100%) Frame = -1 Query: 152 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLAR 3 S+ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLAR Sbjct: 56 SIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLAR 105 >ref|XP_002862747.1| hypothetical protein ARALYDRAFT_333229 [Arabidopsis lyrata subsp. lyrata] gi|297308453|gb|EFH39005.1| hypothetical protein ARALYDRAFT_333229 [Arabidopsis lyrata subsp. lyrata] Length = 137 Score = 99.0 bits (245), Expect = 4e-19 Identities = 49/50 (98%), Positives = 50/50 (100%) Frame = -1 Query: 152 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLAR 3 S+ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLAR Sbjct: 46 SIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLAR 95 >ref|XP_004143093.1| PREDICTED: probable histone H2B.1-like [Cucumis sativus] gi|449508145|ref|XP_004163232.1| PREDICTED: probable histone H2B.1-like [Cucumis sativus] Length = 152 Score = 98.2 bits (243), Expect = 6e-19 Identities = 49/50 (98%), Positives = 50/50 (100%) Frame = -1 Query: 152 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLAR 3 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SKLAR Sbjct: 61 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSKLAR 110