BLASTX nr result
ID: Bupleurum21_contig00000281
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00000281 (763 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAJ38392.1| cytochrome c oxidase subunit 5b [Plantago major] 80 5e-13 gb|ABB87114.1| cytochrome c oxidase family protein-like [Solanum... 80 6e-13 ref|XP_002517575.1| cytochrome C oxidase, putative [Ricinus comm... 79 8e-13 gb|AFK43430.1| unknown [Medicago truncatula] 79 1e-12 dbj|BAJ53249.1| JHL25H03.12 [Jatropha curcas] 79 1e-12 >emb|CAJ38392.1| cytochrome c oxidase subunit 5b [Plantago major] Length = 162 Score = 80.1 bits (196), Expect = 5e-13 Identities = 36/42 (85%), Positives = 41/42 (97%) Frame = -3 Query: 128 REELEAQLQGRDILDINFPEGPFGTKEAPAVVKSYYDKRIVG 3 REEL+A+LQG+DIL+IN+PEGPFGTKE PAVVKSYYDKRIVG Sbjct: 68 REELQAELQGKDILEINYPEGPFGTKEEPAVVKSYYDKRIVG 109 >gb|ABB87114.1| cytochrome c oxidase family protein-like [Solanum tuberosum] Length = 167 Score = 79.7 bits (195), Expect = 6e-13 Identities = 36/42 (85%), Positives = 41/42 (97%) Frame = -3 Query: 128 REELEAQLQGRDILDINFPEGPFGTKEAPAVVKSYYDKRIVG 3 REELEA++QG+D+L INFPEGPFGTKEAPAVV+SYYDKRIVG Sbjct: 73 REELEAEIQGKDLLAINFPEGPFGTKEAPAVVESYYDKRIVG 114 >ref|XP_002517575.1| cytochrome C oxidase, putative [Ricinus communis] gi|223543207|gb|EEF44739.1| cytochrome C oxidase, putative [Ricinus communis] Length = 171 Score = 79.3 bits (194), Expect = 8e-13 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = -3 Query: 128 REELEAQLQGRDILDINFPEGPFGTKEAPAVVKSYYDKRIVG 3 REELEA+LQGRDIL+IN P GPFGTKEAPAVVKSYYDKR+VG Sbjct: 76 REELEAELQGRDILEINHPVGPFGTKEAPAVVKSYYDKRLVG 117 >gb|AFK43430.1| unknown [Medicago truncatula] Length = 156 Score = 79.0 bits (193), Expect = 1e-12 Identities = 36/42 (85%), Positives = 41/42 (97%) Frame = -3 Query: 128 REELEAQLQGRDILDINFPEGPFGTKEAPAVVKSYYDKRIVG 3 REE++AQL+GRDIL+I+ PEGPFGTKEAPAVVKSYYDKRIVG Sbjct: 62 REEIQAQLEGRDILEIDHPEGPFGTKEAPAVVKSYYDKRIVG 103 >dbj|BAJ53249.1| JHL25H03.12 [Jatropha curcas] Length = 165 Score = 79.0 bits (193), Expect = 1e-12 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = -3 Query: 128 REELEAQLQGRDILDINFPEGPFGTKEAPAVVKSYYDKRIVG 3 REELEA+LQG+DIL+IN P GPFGTKEAPAVVKSYYDKRIVG Sbjct: 71 REELEAELQGKDILEINHPVGPFGTKEAPAVVKSYYDKRIVG 112