BLASTX nr result
ID: Bupleurum21_contig00000164
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00000164 (331 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|Q40089.1|ATP4_IPOBA RecName: Full=ATP synthase subunit delta'... 111 5e-23 gb|ACS83604.1| ATP synthase delta subunit 3 [Gossypium hirsutum] 111 5e-23 emb|CAN84027.1| hypothetical protein VITISV_044183 [Vitis vinifera] 111 7e-23 ref|XP_002267995.1| PREDICTED: ATP synthase subunit delta', mito... 110 2e-22 gb|ACS83603.1| ATP synthase delta subunit 2 [Gossypium hirsutum] 109 3e-22 >sp|Q40089.1|ATP4_IPOBA RecName: Full=ATP synthase subunit delta', mitochondrial; AltName: Full=F-ATPase delta' subunit; Flags: Precursor gi|217938|dbj|BAA01511.1| mitochondrial F1-ATPase delta subunit [Ipomoea batatas] Length = 200 Score = 111 bits (278), Expect = 5e-23 Identities = 54/83 (65%), Positives = 68/83 (81%) Frame = +1 Query: 82 MFRHVTARILPRSTPISTRARMFSSDLEASPPTDAAFVEAWKKVVPNIDPPRTPLAFMKP 261 MFRH ++R+L R+T + R R FS+DL A D+ FVEAWKK++PN+DPP+TP A+M P Sbjct: 1 MFRH-SSRLLARATTMGWR-RPFSTDLPAETAADSTFVEAWKKLIPNVDPPKTPSAYMAP 58 Query: 262 RPATPTSIPSKLTVNFVLPYASE 330 RPATP+SIPSKLTVNFVLPY+SE Sbjct: 59 RPATPSSIPSKLTVNFVLPYSSE 81 >gb|ACS83604.1| ATP synthase delta subunit 3 [Gossypium hirsutum] Length = 201 Score = 111 bits (278), Expect = 5e-23 Identities = 51/75 (68%), Positives = 62/75 (82%) Frame = +1 Query: 106 ILPRSTPISTRARMFSSDLEASPPTDAAFVEAWKKVVPNIDPPRTPLAFMKPRPATPTSI 285 +LP + + RAR FS+DL A+P DA F EAW KV+PN+DPP+TPL+FM+PRP TP+SI Sbjct: 8 LLPCRSILPARARPFSTDLPAAPSADATFTEAWTKVIPNMDPPKTPLSFMQPRPPTPSSI 67 Query: 286 PSKLTVNFVLPYASE 330 PSKLTVNFVLPYASE Sbjct: 68 PSKLTVNFVLPYASE 82 >emb|CAN84027.1| hypothetical protein VITISV_044183 [Vitis vinifera] Length = 206 Score = 111 bits (277), Expect = 7e-23 Identities = 55/88 (62%), Positives = 67/88 (76%), Gaps = 5/88 (5%) Frame = +1 Query: 82 MFRHVTARILPR-----STPISTRARMFSSDLEASPPTDAAFVEAWKKVVPNIDPPRTPL 246 M R T R+L R S+ + RAR FS+DL A+P D+ F++AWKK++PNIDPP TPL Sbjct: 1 MLRQAT-RLLARPAIASSSSFAARARPFSTDLPAAPAEDSTFIDAWKKIIPNIDPPATPL 59 Query: 247 AFMKPRPATPTSIPSKLTVNFVLPYASE 330 FM+PRP TP+SIPSKLTVNFVLPYASE Sbjct: 60 TFMQPRPQTPSSIPSKLTVNFVLPYASE 87 >ref|XP_002267995.1| PREDICTED: ATP synthase subunit delta', mitochondrial [Vitis vinifera] gi|297734660|emb|CBI16711.3| unnamed protein product [Vitis vinifera] Length = 206 Score = 110 bits (274), Expect = 2e-22 Identities = 54/88 (61%), Positives = 66/88 (75%), Gaps = 5/88 (5%) Frame = +1 Query: 82 MFRHVTARILPR-----STPISTRARMFSSDLEASPPTDAAFVEAWKKVVPNIDPPRTPL 246 M R T R+L R S+ + RAR FS+DL +P D+ F++AWKK++PNIDPP TPL Sbjct: 1 MLRQAT-RLLARPAIASSSSFAARARSFSTDLPTAPAEDSTFIDAWKKIIPNIDPPATPL 59 Query: 247 AFMKPRPATPTSIPSKLTVNFVLPYASE 330 FM+PRP TP+SIPSKLTVNFVLPYASE Sbjct: 60 TFMQPRPQTPSSIPSKLTVNFVLPYASE 87 >gb|ACS83603.1| ATP synthase delta subunit 2 [Gossypium hirsutum] Length = 201 Score = 109 bits (272), Expect = 3e-22 Identities = 51/83 (61%), Positives = 67/83 (80%) Frame = +1 Query: 82 MFRHVTARILPRSTPISTRARMFSSDLEASPPTDAAFVEAWKKVVPNIDPPRTPLAFMKP 261 MFR + R+L R+T +R FSSD+ A+P D++F+E+W KV+PN+DPP+TP +FM P Sbjct: 1 MFRQAS-RLLARTTTPWRGSRAFSSDVPATPAQDSSFIESWSKVIPNLDPPKTPSSFMTP 59 Query: 262 RPATPTSIPSKLTVNFVLPYASE 330 RPATP++IPSKLTVNFVLPYASE Sbjct: 60 RPATPSAIPSKLTVNFVLPYASE 82