BLASTX nr result
ID: Atropa21_contig00043160
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00043160 (675 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004228785.1| PREDICTED: uncharacterized protein LOC101255... 56 9e-06 >ref|XP_004228785.1| PREDICTED: uncharacterized protein LOC101255821 [Solanum lycopersicum] Length = 1125 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/52 (48%), Positives = 37/52 (71%) Frame = +3 Query: 510 EPQFYQQVVPCPAWQEAMLKKFQALEADNTWDIVLLSSHKKFILSK*VYKIK 665 EP +++ + PAWQ+AM +F+AL A++TW++V+L KK I K VYKIK Sbjct: 1023 EPNTFEEAILHPAWQQAMTHEFEALHANDTWEMVMLPDEKKAIGCKWVYKIK 1074