BLASTX nr result
ID: Atropa21_contig00043040
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00043040 (559 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006366687.1| PREDICTED: early nodulin-93-like [Solanum tu... 58 2e-06 ref|XP_004245139.1| PREDICTED: early nodulin-93-like [Solanum ly... 58 2e-06 ref|XP_004148399.1| PREDICTED: early nodulin-93-like [Cucumis sa... 55 9e-06 ref|XP_002525450.1| Early nodulin, putative [Ricinus communis] g... 55 9e-06 >ref|XP_006366687.1| PREDICTED: early nodulin-93-like [Solanum tuberosum] Length = 113 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/33 (84%), Positives = 28/33 (84%) Frame = -3 Query: 557 PTLVAVRTIPWAKANLNYTAQALIISAGMTLTY 459 PTLVAVRTIPWAKANLNYTAQALIISA Y Sbjct: 59 PTLVAVRTIPWAKANLNYTAQALIISAASIAAY 91 >ref|XP_004245139.1| PREDICTED: early nodulin-93-like [Solanum lycopersicum] Length = 107 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/33 (84%), Positives = 28/33 (84%) Frame = -3 Query: 557 PTLVAVRTIPWAKANLNYTAQALIISAGMTLTY 459 PTLVAVRTIPWAKANLNYTAQALIISA Y Sbjct: 53 PTLVAVRTIPWAKANLNYTAQALIISAASIAAY 85 >ref|XP_004148399.1| PREDICTED: early nodulin-93-like [Cucumis sativus] gi|449507240|ref|XP_004162973.1| PREDICTED: early nodulin-93-like [Cucumis sativus] Length = 116 Score = 55.5 bits (132), Expect = 9e-06 Identities = 26/33 (78%), Positives = 27/33 (81%) Frame = -3 Query: 557 PTLVAVRTIPWAKANLNYTAQALIISAGMTLTY 459 PTLVAVR +PWAKANLNYTAQALIISA Y Sbjct: 57 PTLVAVRVVPWAKANLNYTAQALIISAASIAAY 89 >ref|XP_002525450.1| Early nodulin, putative [Ricinus communis] gi|223535263|gb|EEF36940.1| Early nodulin, putative [Ricinus communis] Length = 128 Score = 55.5 bits (132), Expect = 9e-06 Identities = 27/33 (81%), Positives = 27/33 (81%) Frame = -3 Query: 557 PTLVAVRTIPWAKANLNYTAQALIISAGMTLTY 459 PTLVAVR IPWAKANLNYTAQALIISA Y Sbjct: 74 PTLVAVRVIPWAKANLNYTAQALIISAASISAY 106