BLASTX nr result
ID: Atropa21_contig00041998
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00041998 (735 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAD99220.1| polypeptide with an integrase domain [Petunia x ... 59 2e-06 >dbj|BAD99220.1| polypeptide with an integrase domain [Petunia x hybrida] Length = 492 Score = 58.5 bits (140), Expect = 2e-06 Identities = 34/84 (40%), Positives = 50/84 (59%) Frame = +3 Query: 3 VLHLKSFYKILFGRPHDYSTLKAFGYLVYACTHSPHRSKLDLKVIHSLHFPGISYWEEGF 182 VL+ K Y++LFG DYS LK+FG L + T + HR KL + I + F G + ++G+ Sbjct: 218 VLNGKCPYQVLFGSLPDYSHLKSFGSLCFVSTLTRHRDKLMPRAIPGV-FLGYPFAQKGY 276 Query: 183 *TPRSFNQKIFISRNVKFHESIFP 254 ++ +SR+VKF ESIFP Sbjct: 277 KVLNLQTSQVIVSRDVKFFESIFP 300