BLASTX nr result
ID: Atropa21_contig00041993
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00041993 (480 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006359389.1| PREDICTED: thiamine pyrophosphokinase 2-like... 75 9e-12 ref|XP_006359388.1| PREDICTED: thiamine pyrophosphokinase 2-like... 75 9e-12 ref|XP_004247430.1| PREDICTED: thiamin pyrophosphokinase 1-like ... 75 9e-12 gb|AFK45395.1| unknown [Lotus japonicus] 71 2e-10 ref|XP_004494369.1| PREDICTED: thiamin pyrophosphokinase 1-like ... 69 5e-10 ref|NP_850424.1| thiamin pyrophosphokinase 2 [Arabidopsis thalia... 69 5e-10 dbj|BAH57065.1| AT2G44750 [Arabidopsis thaliana] 69 5e-10 ref|NP_566026.1| thiamin pyrophosphokinase 2 [Arabidopsis thalia... 69 5e-10 ref|XP_006304834.1| hypothetical protein CARUB_v10012506mg, part... 68 1e-09 ref|XP_006285889.1| hypothetical protein CARUB_v10007400mg [Caps... 68 1e-09 ref|NP_849580.1| thiamin pyrophosphokinase1 [Arabidopsis thalian... 68 1e-09 gb|AFK41823.1| unknown [Medicago truncatula] 68 1e-09 ref|XP_003625913.1| Thiamin pyrophosphokinase [Medicago truncatu... 68 1e-09 ref|XP_002892132.1| hypothetical protein ARALYDRAFT_470256 [Arab... 68 1e-09 ref|NP_001117219.1| thiamin pyrophosphokinase1 [Arabidopsis thal... 68 1e-09 ref|NP_849579.1| thiamin pyrophosphokinase1 [Arabidopsis thalian... 68 1e-09 ref|NP_563669.1| thiamin pyrophosphokinase1 [Arabidopsis thalian... 68 1e-09 ref|XP_004290780.1| PREDICTED: thiamin pyrophosphokinase 1-like ... 67 3e-09 ref|XP_006418292.1| hypothetical protein EUTSA_v10008492mg [Eutr... 65 7e-09 ref|XP_002264522.1| PREDICTED: thiamin pyrophosphokinase 1 isofo... 65 1e-08 >ref|XP_006359389.1| PREDICTED: thiamine pyrophosphokinase 2-like isoform X2 [Solanum tuberosum] Length = 192 Score = 75.1 bits (183), Expect = 9e-12 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = -3 Query: 478 NTEMRFGGLVSTSNIVKENLVTVQSDSDLLWTISIKKE 365 NTEMRFGGLVSTSNIVKEN+VTVQSDSDLLWTISIKK+ Sbjct: 155 NTEMRFGGLVSTSNIVKENIVTVQSDSDLLWTISIKKD 192 >ref|XP_006359388.1| PREDICTED: thiamine pyrophosphokinase 2-like isoform X1 [Solanum tuberosum] Length = 279 Score = 75.1 bits (183), Expect = 9e-12 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = -3 Query: 478 NTEMRFGGLVSTSNIVKENLVTVQSDSDLLWTISIKKE 365 NTEMRFGGLVSTSNIVKEN+VTVQSDSDLLWTISIKK+ Sbjct: 242 NTEMRFGGLVSTSNIVKENIVTVQSDSDLLWTISIKKD 279 >ref|XP_004247430.1| PREDICTED: thiamin pyrophosphokinase 1-like [Solanum lycopersicum] Length = 256 Score = 75.1 bits (183), Expect = 9e-12 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = -3 Query: 478 NTEMRFGGLVSTSNIVKENLVTVQSDSDLLWTISIKKE 365 NTEMRFGGLVSTSNIVKEN+VTVQSDSDLLWTISIKK+ Sbjct: 219 NTEMRFGGLVSTSNIVKENIVTVQSDSDLLWTISIKKD 256 >gb|AFK45395.1| unknown [Lotus japonicus] Length = 197 Score = 70.9 bits (172), Expect = 2e-10 Identities = 33/37 (89%), Positives = 37/37 (100%) Frame = -3 Query: 478 NTEMRFGGLVSTSNIVKENLVTVQSDSDLLWTISIKK 368 NTEMRFGGLVSTSNIVKE++VTVQSD+DLLWT+SIKK Sbjct: 160 NTEMRFGGLVSTSNIVKEDIVTVQSDTDLLWTVSIKK 196 >ref|XP_004494369.1| PREDICTED: thiamin pyrophosphokinase 1-like [Cicer arietinum] Length = 263 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = -3 Query: 478 NTEMRFGGLVSTSNIVKENLVTVQSDSDLLWTISIKK 368 NTEMRFGGLVSTSNIVK +++TVQSDSDLLWTISIKK Sbjct: 226 NTEMRFGGLVSTSNIVKGDIITVQSDSDLLWTISIKK 262 >ref|NP_850424.1| thiamin pyrophosphokinase 2 [Arabidopsis thaliana] gi|550600139|sp|F4IV16.1|TPK2_ARATH RecName: Full=Thiamine pyrophosphokinase 2; Short=AtTPK2; AltName: Full=Thiamine kinase 2 gi|330255370|gb|AEC10464.1| thiamin pyrophosphokinase 2 [Arabidopsis thaliana] Length = 267 Score = 69.3 bits (168), Expect = 5e-10 Identities = 31/37 (83%), Positives = 36/37 (97%) Frame = -3 Query: 478 NTEMRFGGLVSTSNIVKENLVTVQSDSDLLWTISIKK 368 NTEMRFGGL+STSN+VKE ++TV+SDSDLLWTISIKK Sbjct: 221 NTEMRFGGLISTSNLVKEEIITVESDSDLLWTISIKK 257 >dbj|BAH57065.1| AT2G44750 [Arabidopsis thaliana] Length = 180 Score = 69.3 bits (168), Expect = 5e-10 Identities = 31/37 (83%), Positives = 36/37 (97%) Frame = -3 Query: 478 NTEMRFGGLVSTSNIVKENLVTVQSDSDLLWTISIKK 368 NTEMRFGGL+STSN+VKE ++TV+SDSDLLWTISIKK Sbjct: 134 NTEMRFGGLISTSNLVKEEIITVESDSDLLWTISIKK 170 >ref|NP_566026.1| thiamin pyrophosphokinase 2 [Arabidopsis thaliana] gi|14596221|gb|AAK68838.1| putative thiamin pyrophosphokinase [Arabidopsis thaliana] gi|20148329|gb|AAM10055.1| putative thiamin pyrophosphokinase [Arabidopsis thaliana] gi|20197027|gb|AAC27477.2| putative thiamin pyrophosphokinase [Arabidopsis thaliana] gi|330255369|gb|AEC10463.1| thiamin pyrophosphokinase 2 [Arabidopsis thaliana] Length = 265 Score = 69.3 bits (168), Expect = 5e-10 Identities = 31/37 (83%), Positives = 36/37 (97%) Frame = -3 Query: 478 NTEMRFGGLVSTSNIVKENLVTVQSDSDLLWTISIKK 368 NTEMRFGGL+STSN+VKE ++TV+SDSDLLWTISIKK Sbjct: 219 NTEMRFGGLISTSNLVKEEIITVESDSDLLWTISIKK 255 >ref|XP_006304834.1| hypothetical protein CARUB_v10012506mg, partial [Capsella rubella] gi|482573545|gb|EOA37732.1| hypothetical protein CARUB_v10012506mg, partial [Capsella rubella] Length = 318 Score = 67.8 bits (164), Expect = 1e-09 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = -3 Query: 478 NTEMRFGGLVSTSNIVKENLVTVQSDSDLLWTISIKK 368 NTEMRFGGL+STSN+VKE +TV+SDSDLLWTISIKK Sbjct: 272 NTEMRFGGLISTSNLVKEEKITVESDSDLLWTISIKK 308 >ref|XP_006285889.1| hypothetical protein CARUB_v10007400mg [Capsella rubella] gi|482554594|gb|EOA18787.1| hypothetical protein CARUB_v10007400mg [Capsella rubella] Length = 263 Score = 67.8 bits (164), Expect = 1e-09 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = -3 Query: 478 NTEMRFGGLVSTSNIVKENLVTVQSDSDLLWTISIKK 368 NTEMRFGGL+STSN+VKE +TV+SDSDLLWTISIKK Sbjct: 217 NTEMRFGGLISTSNLVKEEKITVESDSDLLWTISIKK 253 >ref|NP_849580.1| thiamin pyrophosphokinase1 [Arabidopsis thaliana] gi|550600138|sp|B9DGU7.1|TPK1_ARATH RecName: Full=Thiamine pyrophosphokinase 1; Short=AtTPK1; AltName: Full=Thiamine kinase 1 gi|222424006|dbj|BAH19964.1| AT1G02880 [Arabidopsis thaliana] gi|332189369|gb|AEE27490.1| thiamin pyrophosphokinase1 [Arabidopsis thaliana] Length = 267 Score = 67.8 bits (164), Expect = 1e-09 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = -3 Query: 478 NTEMRFGGLVSTSNIVKENLVTVQSDSDLLWTISIKK 368 NTEMRFGGL+STSN+VKE +TV+SDSDLLWTISIKK Sbjct: 221 NTEMRFGGLISTSNLVKEEKITVESDSDLLWTISIKK 257 >gb|AFK41823.1| unknown [Medicago truncatula] Length = 260 Score = 67.8 bits (164), Expect = 1e-09 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = -3 Query: 478 NTEMRFGGLVSTSNIVKENLVTVQSDSDLLWTISIKK 368 +TEMRFGGLVSTSNIVK ++VTVQSDSDLLWTISIKK Sbjct: 223 DTEMRFGGLVSTSNIVKGDIVTVQSDSDLLWTISIKK 259 >ref|XP_003625913.1| Thiamin pyrophosphokinase [Medicago truncatula] gi|357516337|ref|XP_003628457.1| Thiamin pyrophosphokinase [Medicago truncatula] gi|355500928|gb|AES82131.1| Thiamin pyrophosphokinase [Medicago truncatula] gi|355522479|gb|AET02933.1| Thiamin pyrophosphokinase [Medicago truncatula] gi|388502368|gb|AFK39250.1| unknown [Medicago truncatula] Length = 260 Score = 67.8 bits (164), Expect = 1e-09 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = -3 Query: 478 NTEMRFGGLVSTSNIVKENLVTVQSDSDLLWTISIKK 368 +TEMRFGGLVSTSNIVK ++VTVQSDSDLLWTISIKK Sbjct: 223 DTEMRFGGLVSTSNIVKGDIVTVQSDSDLLWTISIKK 259 >ref|XP_002892132.1| hypothetical protein ARALYDRAFT_470256 [Arabidopsis lyrata subsp. lyrata] gi|297337974|gb|EFH68391.1| hypothetical protein ARALYDRAFT_470256 [Arabidopsis lyrata subsp. lyrata] Length = 266 Score = 67.8 bits (164), Expect = 1e-09 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = -3 Query: 478 NTEMRFGGLVSTSNIVKENLVTVQSDSDLLWTISIKK 368 NTEMRFGGL+STSN+VKE +TV+SDSDLLWTISIKK Sbjct: 220 NTEMRFGGLISTSNLVKEEKITVESDSDLLWTISIKK 256 >ref|NP_001117219.1| thiamin pyrophosphokinase1 [Arabidopsis thaliana] gi|332189370|gb|AEE27491.1| thiamin pyrophosphokinase1 [Arabidopsis thaliana] Length = 180 Score = 67.8 bits (164), Expect = 1e-09 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = -3 Query: 478 NTEMRFGGLVSTSNIVKENLVTVQSDSDLLWTISIKK 368 NTEMRFGGL+STSN+VKE +TV+SDSDLLWTISIKK Sbjct: 134 NTEMRFGGLISTSNLVKEEKITVESDSDLLWTISIKK 170 >ref|NP_849579.1| thiamin pyrophosphokinase1 [Arabidopsis thaliana] gi|16648736|gb|AAL25560.1| At1g02880/F22D16_33 [Arabidopsis thaliana] gi|20856331|gb|AAM26660.1| At1g02880/F22D16_33 [Arabidopsis thaliana] gi|332189367|gb|AEE27488.1| thiamin pyrophosphokinase1 [Arabidopsis thaliana] Length = 197 Score = 67.8 bits (164), Expect = 1e-09 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = -3 Query: 478 NTEMRFGGLVSTSNIVKENLVTVQSDSDLLWTISIKK 368 NTEMRFGGL+STSN+VKE +TV+SDSDLLWTISIKK Sbjct: 151 NTEMRFGGLISTSNLVKEEKITVESDSDLLWTISIKK 187 >ref|NP_563669.1| thiamin pyrophosphokinase1 [Arabidopsis thaliana] gi|6056414|gb|AAF02878.1|AC009525_12 Unknown protein [Arabidopsis thaliana] gi|21553712|gb|AAM62805.1| thiamin pyrophosphokinase, putative [Arabidopsis thaliana] gi|332189368|gb|AEE27489.1| thiamin pyrophosphokinase1 [Arabidopsis thaliana] Length = 264 Score = 67.8 bits (164), Expect = 1e-09 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = -3 Query: 478 NTEMRFGGLVSTSNIVKENLVTVQSDSDLLWTISIKK 368 NTEMRFGGL+STSN+VKE +TV+SDSDLLWTISIKK Sbjct: 218 NTEMRFGGLISTSNLVKEEKITVESDSDLLWTISIKK 254 >ref|XP_004290780.1| PREDICTED: thiamin pyrophosphokinase 1-like [Fragaria vesca subsp. vesca] Length = 258 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = -3 Query: 475 TEMRFGGLVSTSNIVKENLVTVQSDSDLLWTISIKK 368 TEMRFGGL+STSNIVKE+ +TVQSDSDLLWTI+IKK Sbjct: 222 TEMRFGGLISTSNIVKEDKITVQSDSDLLWTITIKK 257 >ref|XP_006418292.1| hypothetical protein EUTSA_v10008492mg [Eutrema salsugineum] gi|557096063|gb|ESQ36645.1| hypothetical protein EUTSA_v10008492mg [Eutrema salsugineum] Length = 265 Score = 65.5 bits (158), Expect = 7e-09 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = -3 Query: 478 NTEMRFGGLVSTSNIVKENLVTVQSDSDLLWTISIKKE 365 NTEMRFGGL+STSN+VK +TV+SDSDLLWTISIKK+ Sbjct: 223 NTEMRFGGLISTSNMVKGEKITVESDSDLLWTISIKKQ 260 >ref|XP_002264522.1| PREDICTED: thiamin pyrophosphokinase 1 isoform 1 [Vitis vinifera] Length = 260 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = -3 Query: 478 NTEMRFGGLVSTSNIVKENLVTVQSDSDLLWTISIKK 368 +TEM+FGGLVSTSNIVK + +TVQSDSDLLWTISIKK Sbjct: 223 DTEMKFGGLVSTSNIVKGDKITVQSDSDLLWTISIKK 259