BLASTX nr result
ID: Atropa21_contig00041990
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00041990 (558 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_173429.1| hypothetical protein NitaMp090 [Nicotiana tabac... 56 7e-06 >ref|YP_173429.1| hypothetical protein NitaMp090 [Nicotiana tabacum] gi|56806593|dbj|BAD83494.1| hypothetical protein (mitochondrion) [Nicotiana tabacum] Length = 119 Score = 55.8 bits (133), Expect = 7e-06 Identities = 28/33 (84%), Positives = 28/33 (84%) Frame = +1 Query: 211 AQVKGESKEEFRIGKEKSSFKRRT*SQGASFPV 309 AQVKGESKEEF GKEK S KRRT SQGASFPV Sbjct: 14 AQVKGESKEEFHFGKEKGSSKRRTQSQGASFPV 46