BLASTX nr result
ID: Atropa21_contig00041923
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00041923 (741 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABI34321.1| RNase H family protein [Solanum demissum] 44 5e-09 >gb|ABI34321.1| RNase H family protein [Solanum demissum] Length = 945 Score = 43.9 bits (102), Expect(2) = 5e-09 Identities = 18/51 (35%), Positives = 28/51 (54%) Frame = +2 Query: 368 DCLCCDTLVPETIQHLLIDSEPAQRLLKFFGQPMGISYISKVVKRFLQNWW 520 +C+CC + ETI H+ ++S+ A L K FG +GI + L+ WW Sbjct: 607 NCVCCKNMKTETINHVFLNSDVASYLWKKFGGTLGIDTRASSTINLLKTWW 657 Score = 43.5 bits (101), Expect(2) = 5e-09 Identities = 15/49 (30%), Positives = 30/49 (61%) Frame = +3 Query: 552 MIQIIPLVICWELYTTRYSCRYGNHTGFYTRKMEQ*IFWNIKAVMNKAY 698 +I +P++I WE++ R +C+YG+ + R ME ++WN+K + + Sbjct: 669 IIHTLPILIFWEIWKRRCACKYGDQKKMWYRTMENHVWWNLKMSLRMTF 717